Diaphorina citri psyllid: psy10905

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MAEGSFVLTELGASSVLHAITAVPGELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSIVNKLDCSKLVPCSESLQSICIEEPLRQDQCHVTSVCILDTCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAILPLGGDIVTIGRGYRSLVSRYTNSTASSQCKENHFALLWSSQNWAAA
cccccEEEEEcccccEEEEEEEEccEEEEECccccEEEEEcccccEEEEEEccccccccccCEEEEEEEccccccEEEEEEccccEEEEEEccccEEEEEECccccccccccccEEECccccccccCEEEEEEECccEEEEEcccEEEEEEEcccccCEEEEccccccEEEEEECcccEEEEcccEEcccEEcccccccccccccEEEEEEEccccccc
***GSFVLTELGASSVLHAITAVPGELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSIVNKLDCSKLVPCSESLQSICIEEPLRQDQCHVTSVCILDTCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAILPLGGDIVTIGRGYRSLVSRYTNSTASSQCKENHFALLWSSQNWA**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEGSFVLTELGASSVLHAITAVPGELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSIVNKLDCSKLVPCSESLQSICIEEPLRQDQCHVTSVCILDTCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAILPLGGDIVTIGRGYRSLVSRYTNSTASSQCKENHFALLWSSQNWAAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031902 [CC]late endosome membraneprobableGO:0005737, GO:0005575, GO:0005770, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0043226, GO:0044422, GO:0010008
GO:0005765 [CC]lysosomal membraneprobableGO:0005737, GO:0044446, GO:0000323, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0005764, GO:0044444, GO:0044437, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AOW, chain A
Confidence level:confident
Coverage over the Query: 14-104,124-153
View the alignment between query and template
View the model in PyMOL
Template: 3MMY, chain A
Confidence level:probable
Coverage over the Query: 15-194
View the alignment between query and template
View the model in PyMOL