Psyllid ID: psy10905

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MAEGSFVLTELGASSVLHAITAVPGELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSIVNKLDCSKLVPCSESLQSICIEEPLRQDQCHVTSVCILDTCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAILPLGGDIVTIGRGYRSLVSRYTNSTASSQCKENHFALLWSSQNWAAA
cccccEEEEEcccccEEEEEEEEccEEEEEEccccEEEEEcccccEEEEEEccccccccccEEEEEEEEccccccEEEEEEccccEEEEEEccccEEEEEEEccccccccccccEEEEccccccccEEEEEEEEEccEEEEEcccEEEEEEEcccccEEEEEccccccEEEEEEEcccEEEEcccEEcccEEcccccccccccccEEEEEEEccccccc
cccccEEEEEcccccEEEEEEEEccEEEEEcccccEEEEEEccccEEccEEEEcccccccccEEEEEEEccccccEEEEEEccccEEEEEEEcEEEEEEEccHHHcccccccccEEEcHccccccccEEEEEEEcccEEEEEcccEEEEEEEccccccEEEEEcccccEEEEEEccccEEEEccccHHHHHHcccccccccccccEEEEEEEccccccc
MAEGSFVLTELGASSVLHAitavpgelwcgesdgnisiytmsehsvtshdtvnhfhpvisnvdvsflvsspstsaWVWSyvypgcsvyqwdtQARSIvnkldcsklvpcseslqsicieeplrqdqchvtsvcildtclyigTTWGCIVVAekdslrpitvfrpYEELVTAIlplggdivtiGRGYRSLVSRYtnstassqckENHFALLWSSQNWAAA
MAEGSFVLTELGASSVLHAITAVPGELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSIVNKLDCSKLVPCSESLQSICIeeplrqdqcHVTSVCILDTCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTailplggdivTIGRGYRSLVSRYTNSTASSQCKENHFALLWSSQNWAAA
MAEGSFVLTELGASSVLHAITAVPGELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSIVNKLDCSKLVPCSESLQSICIEEPLRQDQCHVTSVCILDTCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAILPLGGDIVTIGRGYRSLVSRYTNSTASSQCKENHFALLWSSQNWAAA
*****FVLTELGASSVLHAITAVPGELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSIVNKLDCSKLVPCSESLQSICIEEPLRQDQCHVTSVCILDTCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAILPLGGDIVTIGRGYRSLVSRYTNSTASSQCKENHFALLWSS******
***GSFVLTELGASSVLHAITAVPGELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSIVNKLDCSKLVPCS*************QDQCHVTSVCILDTCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAILPLGGDIVTIGRGYRSLVS*************NHFALLWSSQNWA**
MAEGSFVLTELGASSVLHAITAVPGELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSIVNKLDCSKLVPCSESLQSICIEEPLRQDQCHVTSVCILDTCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAILPLGGDIVTIGRGYRSLVSRYTNSTASSQCKENHFALLWSSQNWAAA
***GSFVLTELGASSVLHAITAVPGELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSIVNKLDCSKLVPCSESLQSICIEEPLRQDQCHVTSVCILDTCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAILPLGGDIVTIGRGYRSLVSRYTNSTASSQCKENHFALLWSSQN****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEGSFVLTELGASSVLHAITAVPGELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSIVNKLDCSKLVPCSESLQSICIEEPLRQDQCHVTSVCILDTCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAILPLGGDIVTIGRGYRSLVSRYTNSTASSQCKENHFALLWSSQNWAAA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query219 2.2.26 [Sep-21-2011]
Q9TZM32393 Leucine-rich repeat serin yes N/A 0.630 0.057 0.298 1e-09
>sp|Q9TZM3|LRK1_CAEEL Leucine-rich repeat serine/threonine-protein kinase 1 OS=Caenorhabditis elegans GN=lrk-1 PE=1 SV=6 Back     alignment and function desciption
 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 78/154 (50%), Gaps = 16/154 (10%)

Query: 26   ELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVD---VSFLVSSPSTSAWVWSYVY 82
            ++W G S+G ISI     H + S+D+ +    +    D   V  LV S      VW  + 
Sbjct: 2155 QIWAGHSEGRISI-----HHIASNDSFSFSSSLYLPDDKCIVRQLVGSKDAQK-VWIALE 2208

Query: 83   PGCSVYQWDTQARSIVNKLDCSKLVPCSESLQSICIEEPLRQDQCHVTSVCILDTC---- 138
                V   + + R +   LD  K++P SE++ +I +E      Q +VT + +L+      
Sbjct: 2209 KSSKVQMVEVEKRQVTGSLDIRKVMPGSETIHTIDME---MASQNYVTCIGLLERNDGDQ 2265

Query: 139  LYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAI 172
            LYIGT+ G +V+A   +L+P++  RP+E  +T+I
Sbjct: 2266 LYIGTSKGLLVIAHATTLQPLSACRPFEGDITSI 2299
Determines polarized sorting of synaptic vesicle (SV) proteins to the axons by excluding SV proteins from the dendrite-specific transport machinery in the Golgi. Role in stress response. Appears to antagonize the effects of pink-1 both in the regulation of axon guidance and stress response.
Caenorhabditis elegans (taxid: 6239)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query219
270002127 2561 hypothetical protein TcasGA2_TC001087 [T 0.977 0.083 0.489 5e-62
328725069 2485 PREDICTED: leucine-rich repeat serine/th 0.990 0.087 0.488 4e-54
242014236 2492 conserved hypothetical protein [Pediculu 0.949 0.083 0.467 4e-50
321467470 1563 hypothetical protein DAPPUDRAFT_320464 [ 0.981 0.137 0.417 8e-49
241758391 2382 conserved hypothetical protein [Ixodes s 0.872 0.080 0.479 9e-49
157118786 2327 hypothetical protein AaeL_AAEL008398 [Ae 0.968 0.091 0.428 1e-48
321459038 597 hypothetical protein DAPPUDRAFT_113034 [ 0.981 0.360 0.417 1e-48
198450668 2041 GA18916 [Drosophila pseudoobscura pseudo 0.972 0.104 0.459 8e-47
161078441 2445 Leucine-rich repeat kinase, isoform B [D 0.899 0.080 0.495 3e-46
347964550 2866 AGAP000810-PA [Anopheles gambiae str. PE 0.986 0.075 0.418 3e-46
>gi|270002127|gb|EEZ98574.1| hypothetical protein TcasGA2_TC001087 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 166/249 (66%), Gaps = 35/249 (14%)

Query: 2    AEGSFVLTELGASSVLHAITAVPG------ELWCGESDGNISIYTMSEHSVTSHDTVNHF 55
            AEG+FV+TELG++SV++ + A+        ELWCGES+G ISI+ + +H V   +T+NH+
Sbjct: 2315 AEGTFVMTELGSNSVINCLCAIFKDGGAVCELWCGESNGQISIFIIKDHVVAGRETMNHY 2374

Query: 56   HPVISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSIVNKLDCSKLVPCSESLQS 115
             P+I  V+V  L+++ +    VWSYV PGC +YQWD + R+I+NKLDCSKLVPCSESL+S
Sbjct: 2375 QPIIEQVNVMNLIAADN---HVWSYVRPGCIIYQWDQKNRTIINKLDCSKLVPCSESLKS 2431

Query: 116  ICIEEPLRQDQCHVTSVCILDTCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAILPL 175
            I IEE L    C VTS+ +L+  LYIGTTWGC+++AE+ +LRPIT+FRPYEE V AI+PL
Sbjct: 2432 IAIEEHLSPTNCQVTSLAVLNEELYIGTTWGCVIIAERATLRPITIFRPYEEEVKAIVPL 2491

Query: 176  G------------GDIVTIGRGYRSLVSRYTNSTASS--------------QCKENHFAL 209
                           I TIGRGYR+L+SRYT+   S+                K+N F L
Sbjct: 2492 AMCKSINESHDNTPLIATIGRGYRNLLSRYTDVPVSTGHSLQSPMSNAPVVANKQNMFVL 2551

Query: 210  LWSSQNWAA 218
            LW +++W A
Sbjct: 2552 LWRAEHWNA 2560

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328725069|ref|XP_003248335.1| PREDICTED: leucine-rich repeat serine/threonine-protein kinase 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242014236|ref|XP_002427797.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212512266|gb|EEB15059.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|321467470|gb|EFX78460.1| hypothetical protein DAPPUDRAFT_320464 [Daphnia pulex] Back     alignment and taxonomy information
>gi|241758391|ref|XP_002401822.1| conserved hypothetical protein [Ixodes scapularis] gi|215508510|gb|EEC17964.1| conserved hypothetical protein [Ixodes scapularis] Back     alignment and taxonomy information
>gi|157118786|ref|XP_001653260.1| hypothetical protein AaeL_AAEL008398 [Aedes aegypti] gi|108875599|gb|EAT39824.1| AAEL008398-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|321459038|gb|EFX70096.1| hypothetical protein DAPPUDRAFT_113034 [Daphnia pulex] Back     alignment and taxonomy information
>gi|198450668|ref|XP_001358078.2| GA18916 [Drosophila pseudoobscura pseudoobscura] gi|198131136|gb|EAL27215.2| GA18916 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|161078441|ref|NP_001097847.1| Leucine-rich repeat kinase, isoform B [Drosophila melanogaster] gi|94537500|gb|ABF29833.1| leucine-rich repeat kinase [Drosophila melanogaster] gi|158030315|gb|AAF55793.3| Leucine-rich repeat kinase, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|347964550|ref|XP_311349.5| AGAP000810-PA [Anopheles gambiae str. PEST] gi|333467584|gb|EAA06914.5| AGAP000810-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query219
FB|FBgn00388162445 Lrrk "Leucine-rich repeat kina 0.894 0.080 0.502 2.2e-45
WB|WBGene000030682393 lrk-1 [Caenorhabditis elegans 0.630 0.057 0.298 6.7e-09
FB|FBgn0038816 Lrrk "Leucine-rich repeat kinase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 493 (178.6 bits), Expect = 2.2e-45, P = 2.2e-45
 Identities = 105/209 (50%), Positives = 144/209 (68%)

Query:     2 AEGSFVLTELGASSVLHAITAV--PG--ELWCGESDGNISIYTMSEHSVTSHDTVNHFH- 56
             AEGSFVLTE+ +  VLHA  +V   G  ELWCGE  G I+++ ++E+ V+ H  + H   
Sbjct:  2203 AEGSFVLTEICSGFVLHAACSVVVDGIYELWCGEIAGKINVFPLNENGVSGHQALCHSEE 2262

Query:    57 P-VISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSIVNKLDCSKLVPCSESLQS 115
             P +I +V V+ + S+ S    V+S +YPGC VYQWD  ++ I NKLDCSKL+PCSESLQS
Sbjct:  2263 PNLIEDVKVARMCSNESH---VFSCLYPGCMVYQWDVISKRIENKLDCSKLLPCSESLQS 2319

Query:   116 ICIEEPLRQDQCHVTSVCILDTCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAILPL 175
             I I+E +   +C ++++   ++ LYIGTTWGC++VAE  +LRPI+VFRPYE  + +I+ L
Sbjct:  2320 IAIDEHVNLIKCQISALAAHNSELYIGTTWGCLIVAELHTLRPISVFRPYENEIKSIITL 2379

Query:   176 GGD----IVTIGRGYRSLVSRYTNSTASS 200
               D    I TIGR YRSL+SRY +S  SS
Sbjct:  2380 SKDNVPLIATIGRRYRSLISRYVDSAESS 2408
GO:0004672 "protein kinase activity" evidence=ISS;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IDA;IMP
GO:0050808 "synapse organization" evidence=IMP
GO:0017137 "Rab GTPase binding" evidence=IPI
GO:0032418 "lysosome localization" evidence=IGI;IMP
GO:0005765 "lysosomal membrane" evidence=IDA
GO:0031902 "late endosome membrane" evidence=IDA
WB|WBGene00003068 lrk-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 219
KOG3522|consensus925 98.38
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.16
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 96.46
KOG0266|consensus456 96.08
KOG0274|consensus 537 95.93
KOG0279|consensus315 95.52
KOG1273|consensus 405 95.18
KOG0294|consensus362 94.83
PTZ00421 493 coronin; Provisional 93.92
PTZ00420 568 coronin; Provisional 93.91
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.68
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.34
KOG0310|consensus 487 93.26
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 93.0
KOG0305|consensus 484 92.85
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 92.81
PLN00181793 protein SPA1-RELATED; Provisional 92.62
KOG2106|consensus 626 92.54
KOG1036|consensus323 92.24
KOG3522|consensus 925 92.19
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 91.53
KOG4378|consensus 673 91.19
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 90.83
PLN00181793 protein SPA1-RELATED; Provisional 90.81
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 90.25
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 89.93
KOG0646|consensus 476 89.79
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 89.23
KOG0315|consensus311 89.17
KOG1587|consensus 555 88.75
KOG4499|consensus310 88.31
KOG1240|consensus 1431 87.85
KOG0296|consensus399 87.53
KOG0266|consensus456 87.24
KOG3881|consensus412 87.24
KOG0296|consensus399 86.48
KOG2321|consensus 703 84.25
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 83.07
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 82.69
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 82.54
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 82.39
KOG0646|consensus476 82.18
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 81.31
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 81.0
KOG0274|consensus537 80.31
KOG4547|consensus 541 80.14
>KOG3522|consensus Back     alignment and domain information 
Probab=98.38  E-value=8.4e-07  Score=90.33  Aligned_cols=178  Identities=20%  Similarity=0.283  Sum_probs=127.3

Q ss_pred             eeeeeecceeeecccCCcEEEEEccCCceEeeeeeeccCCccccceeEEEeecCCCCceEEEEEeCCcEEEEEeccccee
Q psy10905         18 HAITAVPGELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSI   97 (219)
Q Consensus        18 ~s~a~v~~eLW~G~~~g~Isi~~l~~~~vs~~~~l~h~~~~~~~~~V~~L~~~~~~~~~Vwsyv~pg~~Vyqw~~~tr~I   97 (219)
                      +.+--|+--|||   +|.|+|.+  ...+.-.--+.-..+  +++ +.+|..   +.-.|||-+.-..-+.-++.+|++-
T Consensus       718 ~kllsv~~rl~c---~gl~~V~~--~~~l~v~~~v~~~q~--~k~-~~~~~v---S~~~~~~~vk~~~~~~~~H~~~~~~  786 (925)
T KOG3522|consen  718 GKLLSVPGRLWC---QGLLMVLT--SLTLLVALPVPRLQD--SKV-TGRMMV---SYHAVWSPVKFSAHATALHEKTKDK  786 (925)
T ss_pred             cccccCCCcccc---cceeEEec--cceeEEEeeeeeccC--Cce-eeeeee---ecccccccchhhhhhhhhccchHhh
Confidence            555556689999   69999984  334544444444444  333 444441   4446999999999999999999998


Q ss_pred             eeeeeccccccCCCCcccccccccccccCceeeeEeeecceEEEecceeEEEEEecCcceeeeeecccccceeEEeeec-
Q psy10905         98 VNKLDCSKLVPCSESLQSICIEEPLRQDQCHVTSVCILDTCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAILPLG-  176 (219)
Q Consensus        98 ~~~LD~skl~PcSEsl~si~iee~l~~~~~qVtaL~~~~~~LYIGTtwG~iiVaea~tLrPit~frp~e~~V~~Ii~l~-  176 (219)
                      ....|.-.=+|  .++.--|  +=.++++.+++|+..+++-+|+||+.|.++.--++.   -..=..|.++|++..-+. 
T Consensus       787 ~~e~~~~~p~~--~~~~~~D--ai~~~~~~~~~s~~~~~~~iW~G~S~G~~~~~~~~~---t~~g~~~~~H~~~~~~~~~  859 (925)
T KOG3522|consen  787 SREVLAPPPVP--QMLDQKD--AIIKAACLRSTSLLDCDALIWLGTSAGVMLTKPDLS---TGSGSGHTGHVRFLLEVRS  859 (925)
T ss_pred             hhhccCCCCCc--hhhhccc--hhhhchhhhhccccCchhheeeccccceeeeccCCC---CCCCCccccceeeeEeeec
Confidence            88888877444  3333322  223789999999999999999999999998766554   555678899999988664 


Q ss_pred             -C---------------------------eEEEeccccccceeecccCc-cccccCCCeEEEEeec
Q psy10905        177 -G---------------------------DIVTIGRGYRSLVSRYTNST-ASSQCKENHFALLWSS  213 (219)
Q Consensus       177 -g---------------------------~l~TiG~GyR~L~~r~~~~~-~s~~~~~~~~~llWr~  213 (219)
                       |                           -|++.|+|||++...=.+.+ ........+|++|||.
T Consensus       860 ~~~~~~~~~~p~s~rS~~~r~~k~~~~~~Lvi~GG~G~~~~~~s~~~~~~E~a~~~~~~~l~l~~i  925 (925)
T KOG3522|consen  860 EGTIYDLLKDPVSLRSKAHRAKKAKASSALVISGGDGYEDFRKSGQPSQSELAGTDSTNHLLLWNI  925 (925)
T ss_pred             CceehhcCCCcccccchhhccccccCCceEEEeCCcchHHHHhcCCCchhhhCccccccceeeecC
Confidence             1                           19999999999872222222 1123678899999984

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG3522|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query219
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 39.8 bits (92), Expect = 5e-04
 Identities = 36/213 (16%), Positives = 60/213 (28%), Gaps = 75/213 (35%)

Query: 39  YTMSEHSVTSHDTVNHFHP-----------------VISNVDVSFLVSSPSTSAWVWSYV 81
           +   EH     D ++ F                   ++S  ++  ++ S           
Sbjct: 9   FETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDA-------- 60

Query: 82  YPGCSVYQWDTQARSIVNKLDCSKLVPCSESLQSICIEEPLRQD----------QCHVTS 131
                     +    +   L  SK     E +    +EE LR +          +    S
Sbjct: 61  ---------VSGTLRLFWTL-LSK----QEEMVQKFVEEVLRINYKFLMSPIKTEQRQPS 106

Query: 132 VCILDTCLYIGT---TWGCIVVAEKDSLRPITVFR--PYEELVTAILPL-GGDIVTI--- 182
              + T +YI      +      +        V R  PY +L  A+L L     V I   
Sbjct: 107 ---MMTRMYIEQRDRLYN-----DNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGV 158

Query: 183 -GRGYRSLVSRYTNSTASS---QCKENHFALLW 211
            G G   +          S   QCK + F + W
Sbjct: 159 LGSGKTWVA----LDVCLSYKVQCKMD-FKIFW 186

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query219
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 97.85
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 97.81
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 97.73
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.7
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.7
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.69
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.65
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.62
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.58
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 97.58
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.53
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.53
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.53
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 97.52
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.51
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.48
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 97.48
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 97.47
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.46
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.45
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.43
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.43
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 97.42
3jrp_A 379 Fusion protein of protein transport protein SEC13 97.39
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.38
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.35
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.31
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 97.31
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.31
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 97.28
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.25
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.24
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.2
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 97.2
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.19
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 97.16
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.15
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.14
3jrp_A 379 Fusion protein of protein transport protein SEC13 97.12
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 97.07
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.05
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.05
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 97.03
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.02
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.01
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 96.98
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.96
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.92
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.91
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.88
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 96.88
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.79
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 96.79
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.78
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.77
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 96.76
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.74
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 96.73
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.71
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.66
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.66
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.65
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.59
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.59
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 96.55
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.53
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.5
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.47
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.47
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.43
3jro_A 753 Fusion protein of protein transport protein SEC13 96.4
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.38
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.34
3jro_A 753 Fusion protein of protein transport protein SEC13 96.31
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.26
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.24
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.21
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.19
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.14
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.11
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.03
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.96
2xyi_A430 Probable histone-binding protein CAF1; transcripti 95.95
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.92
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 95.87
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.82
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 95.77
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.71
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 95.7
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.69
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.63
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.61
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 95.56
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 95.5
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 95.5
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 95.5
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 95.47
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 95.46
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.42
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 95.41
2pm7_B297 Protein transport protein SEC13, protein transport 95.25
3v9f_A 781 Two-component system sensor histidine kinase/RESP 95.2
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.17
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 95.03
3v9f_A 781 Two-component system sensor histidine kinase/RESP 95.03
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 95.01
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.97
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.82
4a2l_A 795 BT_4663, two-component system sensor histidine kin 94.73
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 94.7
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.69
4a2l_A 795 BT_4663, two-component system sensor histidine kin 94.52
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 94.47
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 94.46
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 94.46
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.36
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 94.34
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 94.18
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 94.13
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 94.13
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.11
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 93.72
2ymu_A577 WD-40 repeat protein; unknown function, two domain 93.67
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 93.41
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 93.33
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 93.23
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 93.09
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 92.99
3ott_A 758 Two-component system sensor histidine kinase; beta 92.92
4e54_B435 DNA damage-binding protein 2; beta barrel, double 92.75
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 92.59
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 92.45
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 92.35
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 92.23
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 91.98
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 91.98
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 91.8
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 91.79
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 91.75
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 91.75
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 91.72
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 91.68
2pm7_B297 Protein transport protein SEC13, protein transport 91.65
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 91.5
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 91.49
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 91.3
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 90.79
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 90.55
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 90.31
3ott_A 758 Two-component system sensor histidine kinase; beta 89.87
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 89.81
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 89.73
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 89.58
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 89.37
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 88.53
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 87.81
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 87.62
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 86.07
2fp8_A322 Strictosidine synthase; six bladed beta propeller 85.69
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 85.55
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 84.85
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 84.04
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 83.43
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 82.88
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 82.76
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 81.8
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 81.42
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 81.02
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 80.69
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 80.39
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=97.85  E-value=0.0022  Score=54.42  Aligned_cols=152  Identities=10%  Similarity=0.108  Sum_probs=100.3

Q ss_pred             eeeeeeeec--ceeeecccCCcEEEEEccCCceEeeeeeeccCCccccceeEEEeecCC--CCceEEEEEeCCcEEEEEe
Q psy10905         16 VLHAITAVP--GELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVDVSFLVSSPS--TSAWVWSYVYPGCSVYQWD   91 (219)
Q Consensus        16 ~i~s~a~v~--~eLW~G~~~g~Isi~~l~~~~vs~~~~l~h~~~~~~~~~V~~L~~~~~--~~~~Vwsyv~pg~~Vyqw~   91 (219)
                      .+.++++-+  ..|-+|..+|.|.||+++.......-.+.|.      ..|..++..+.  ........-..+..|+.||
T Consensus       216 ~v~~~~~s~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~------~~v~~~~~~~~~s~~~~~l~s~~~dg~i~iwd  289 (437)
T 3gre_A          216 AVSSICIDEECCVLILGTTRGIIDIWDIRFNVLIRSWSFGDH------APITHVEVCQFYGKNSVIVVGGSSKTFLTIWN  289 (437)
T ss_dssp             CEEEEEECTTSCEEEEEETTSCEEEEETTTTEEEEEEBCTTC------EEEEEEEECTTTCTTEEEEEEESTTEEEEEEE
T ss_pred             ceEEEEECCCCCEEEEEcCCCeEEEEEcCCccEEEEEecCCC------CceEEEEeccccCCCccEEEEEcCCCcEEEEE
Confidence            466777654  7799999999999999997544332222332      24666643221  1122333344556899999


Q ss_pred             cccceeeeeeecc-------ccccCCCCcccccccccccccCceeeeEeeecc-eEEEecceeEEEEEecCcceeeeeec
Q psy10905         92 TQARSIVNKLDCS-------KLVPCSESLQSICIEEPLRQDQCHVTSVCILDT-CLYIGTTWGCIVVAEKDSLRPITVFR  163 (219)
Q Consensus        92 ~~tr~I~~~LD~s-------kl~PcSEsl~si~iee~l~~~~~qVtaL~~~~~-~LYIGTtwG~iiVaea~tLrPit~fr  163 (219)
                      ..+++....+.-.       ++.|..+.+..+.+..  ......|++|+..++ .|+.|..-|.|.+-+..+.+++..+.
T Consensus       290 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~--~~~~~~v~~l~~~~~~~l~s~~~d~~i~~wd~~~~~~~~~~~  367 (437)
T 3gre_A          290 FVKGHCQYAFINSDEQPSMEHFLPIEKGLEELNFCG--IRSLNALSTISVSNDKILLTDEATSSIVMFSLNELSSSKAVI  367 (437)
T ss_dssp             TTTTEEEEEEESSSSCCCGGGGSCBCSSGGGCCCCC--CCSGGGGCCEEEETTEEEEEEGGGTEEEEEETTCGGGCEEEE
T ss_pred             cCCCcEEEEEEcCCCCCccceecccccccccceecc--cccCCceEEEEECCceEEEecCCCCeEEEEECCCcccceEEe
Confidence            9999988888743       3444444443333222  125667999999875 68889889999999999999999999


Q ss_pred             ccccceeEEeee
Q psy10905        164 PYEELVTAILPL  175 (219)
Q Consensus       164 p~e~~V~~Ii~l  175 (219)
                      ++......+.++
T Consensus       368 ~~~~~~~~~~~~  379 (437)
T 3gre_A          368 SPSRFSDVFIPT  379 (437)
T ss_dssp             CC--CCCEEEEE
T ss_pred             cccccCceEEEE
Confidence            877666555554
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query219
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.48
d1tbga_340 beta1-subunit of the signal-transducing G protein 97.28
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 97.11
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 97.04
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.03
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.69
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.66
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 96.55
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.48
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.41
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.39
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 96.3
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 96.23
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 96.23
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 95.82
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 95.76
d1tbga_340 beta1-subunit of the signal-transducing G protein 95.17
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.14
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 94.88
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 94.79
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.7
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 94.62
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 94.23
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 93.71
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 93.49
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 93.37
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.14
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 92.53
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 92.03
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 91.07
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 90.83
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 90.81
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 90.67
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 89.54
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 89.54
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 88.75
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 88.35
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 88.35
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 87.74
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 87.7
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 87.33
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 86.92
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 85.43
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 83.49
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 81.96
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Tup1, C-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.48  E-value=0.011  Score=46.22  Aligned_cols=141  Identities=13%  Similarity=0.082  Sum_probs=82.3

Q ss_pred             ceeeecccCCcEEEEEccCCceEeeeeeeccCCccccceeEEEeecCCCCceEEEEEeCCcEEEEEecccceeeeeeecc
Q psy10905         25 GELWCGESDGNISIYTMSEHSVTSHDTVNHFHPVISNVDVSFLVSSPSTSAWVWSYVYPGCSVYQWDTQARSIVNKLDCS  104 (219)
Q Consensus        25 ~eLW~G~~~g~Isi~~l~~~~vs~~~~l~h~~~~~~~~~V~~L~~~~~~~~~Vwsyv~pg~~Vyqw~~~tr~I~~~LD~s  104 (219)
                      ..|-+|..+|.|.+|+++.....................|..|.-.+ +...+-+ ...+..|+.||..+.+........
T Consensus       218 ~~l~~~~~d~~i~i~~~~~~~~~~~~~~~~~~~~~h~~~v~~l~~s~-~~~~l~s-~~~d~~i~iwd~~~~~~~~~~~~~  295 (388)
T d1erja_         218 KYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTR-DGQSVVS-GSLDRSVKLWNLQNANNKSDSKTP  295 (388)
T ss_dssp             CEEEEEETTSCEEEEETTTCCEEEEEC------CCCSSCEEEEEECT-TSSEEEE-EETTSEEEEEEC------------
T ss_pred             CeEEEEcCCCeEEEeecccCccceeeccccccccCCCCCEEEEEECC-CCCEEEE-EECCCcEEEEeccCCccccccccc
Confidence            56788889999999998865433221111000011123466665433 3333433 344568999999887765444332


Q ss_pred             ccccCCCCcccccccccccccCceeeeEeeec--ceEEEecceeEEEEEecCcceeeeeecccccceeEEeeec
Q psy10905        105 KLVPCSESLQSICIEEPLRQDQCHVTSVCILD--TCLYIGTTWGCIVVAEKDSLRPITVFRPYEELVTAILPLG  176 (219)
Q Consensus       105 kl~PcSEsl~si~iee~l~~~~~qVtaL~~~~--~~LYIGTtwG~iiVaea~tLrPit~frp~e~~V~~Ii~l~  176 (219)
                      .--.+.     ...    ......|++++...  ..|+.|..-|.|.+-|..+-+|+..|+.|++.|.++....
T Consensus       296 ~~~~~~-----~~~----~~~~~~v~~~~~s~~~~~l~sg~~dg~i~vwd~~~~~~~~~l~~H~~~V~~~~~~~  360 (388)
T d1erja_         296 NSGTCE-----VTY----IGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVAN  360 (388)
T ss_dssp             ---CEE-----EEE----ECCSSCEEEEEECGGGCEEEEEETTSEEEEEETTTCCEEEEEECCSSCEEEEEECS
T ss_pred             ccccee-----eec----ccccceEEEEEECCCCCEEEEEeCCCEEEEEECCCCcEEEEEeCCCCCEEEEEEec
Confidence            211100     001    22356788888864  6788899999999999999999999999999999887654
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure