Diaphorina citri psyllid: psy1090


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MDTVIPDPTRYRKSGKVIAFFCKIIEEQALEPNLIVCPLSVLNNWEAEFRKFAPFVRTVKYYGNAIERKALQSEALSLPTIKVPAKKGKTKKQISLKLPLILVTTPQIIENDFGFLKKITWNCIIVDEGHSVKNKKSKLSIKLTALRATFKVLLTGWYYPNKWSKQCTL
ccccccccccccHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHcccccccccccccccccccccccccEEEccHHHHHHHHHHHccccccEEEEEccccccccccHHHHHHcccccccEEEEEcccccccHHHHHcc
MDTVIPDPTRYRKSGKVIAFFCKIIEEQALEPNLIVCPLSVLNNWEAEFRKFAPFVRTVKYYGNAIERKALQSEALSL*************KQISLKLPLILVTTPQIIENDFGFLKKITWNCIIVDEGHSVKNKKSKLSIKLTALRATFKVLLTGWYYPNKWSKQCTL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTVIPDPTRYRKSGKVIAFFCKIIEEQALEPNLIVCPLSVLNNWEAEFRKFAPFVRTVKYYGNAIERKALQSEALSLPTIKVPAKKGKTKKQISLKLPLILVTTPQIIENDFGFLKKITWNCIIVDEGHSVKNKKSKLSIKLTALRATFKVLLTGWYYPNKWSKQCTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0016568 [BP]chromatin modificationprobableGO:0006996, GO:0051276, GO:0006325, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:1901363 [MF]heterocyclic compound bindingprobableGO:0003674, GO:0005488
GO:0042393 [MF]histone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045111 [CC]intermediate filament cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0097159 [MF]organic cyclic compound bindingprobableGO:0003674, GO:0005488
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0090544 [CC]BAF-type complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0070603, GO:0043227, GO:0043226, GO:0044422
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0044451 [CC]nucleoplasm partprobableGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MWY, chain W
Confidence level:very confident
Coverage over the Query: 1-80,94-169
View the alignment between query and template
View the model in PyMOL