Psyllid ID: psy1090
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 169 | ||||||
| 302796603 | 1274 | hypothetical protein SELMODRAFT_177985 [ | 0.976 | 0.129 | 0.365 | 2e-19 | |
| 302811536 | 1292 | hypothetical protein SELMODRAFT_158748 [ | 0.976 | 0.127 | 0.365 | 2e-19 | |
| 302803789 | 1296 | hypothetical protein SELMODRAFT_155996 [ | 0.976 | 0.127 | 0.364 | 8e-19 | |
| 302817780 | 1296 | hypothetical protein SELMODRAFT_185367 [ | 0.976 | 0.127 | 0.364 | 8e-19 | |
| 393217224 | 1030 | hypothetical protein FOMMEDRAFT_122741 [ | 0.863 | 0.141 | 0.346 | 2e-18 | |
| 356562107 | 2586 | PREDICTED: uncharacterized protein LOC10 | 0.893 | 0.058 | 0.383 | 2e-18 | |
| 242094948 | 1147 | hypothetical protein SORBIDRAFT_10g00563 | 0.893 | 0.131 | 0.356 | 5e-18 | |
| 297802844 | 1221 | hypothetical protein ARALYDRAFT_328538 [ | 0.834 | 0.115 | 0.367 | 6e-18 | |
| 321263641 | 926 | helicase [Cryptococcus gattii WM276] gi| | 0.911 | 0.166 | 0.363 | 6e-18 | |
| 405123404 | 926 | helicase [Cryptococcus neoformans var. g | 0.917 | 0.167 | 0.359 | 6e-18 |
| >gi|302796603|ref|XP_002980063.1| hypothetical protein SELMODRAFT_177985 [Selaginella moellendorffii] gi|300152290|gb|EFJ18933.1| hypothetical protein SELMODRAFT_177985 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
Score = 100 bits (250), Expect = 2e-19, Method: Composition-based stats.
Identities = 61/167 (36%), Positives = 89/167 (53%), Gaps = 2/167 (1%)
Query: 4 VIPDPTRYRKSGKVIAFFCKIIEEQALEPNLIVCPLSVLNNWEAEFRKFAPFVRTVKYYG 63
++ D K+ + I+F ++ E P+LIV PLS L NWE EF +AP + V Y G
Sbjct: 291 ILADEMGLGKTIQTISFLTSLLHEGVSLPHLIVAPLSTLRNWEREFSIWAPQMSIVTYIG 350
Query: 64 NAIERKALQSEALSLPTIKVPAK-KGKTKKQISLKLPLILVTTPQIIENDFGFLKKITWN 122
+A R+ ++ + LP + P K K +Q +K +L+T+ +++ D LK I W
Sbjct: 351 SAQAREIIRQKEFFLPKERKPEKGKKNASRQRRVKFN-VLLTSYEMVNTDSAVLKPIKWE 409
Query: 123 CIIVDEGHSVKNKKSKLSIKLTALRATFKVLLTGWYYPNKWSKQCTL 169
C+IVDEGH +KNK SKL L +VLLTG N + TL
Sbjct: 410 CLIVDEGHRLKNKDSKLFQTLHNYSTYSRVLLTGTPLQNNLDELFTL 456
|
Source: Selaginella moellendorffii Species: Selaginella moellendorffii Genus: Selaginella Family: Selaginellaceae Order: Selaginellales Class: Isoetopsida Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|302811536|ref|XP_002987457.1| hypothetical protein SELMODRAFT_158748 [Selaginella moellendorffii] gi|300144863|gb|EFJ11544.1| hypothetical protein SELMODRAFT_158748 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
| >gi|302803789|ref|XP_002983647.1| hypothetical protein SELMODRAFT_155996 [Selaginella moellendorffii] gi|300148484|gb|EFJ15143.1| hypothetical protein SELMODRAFT_155996 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
| >gi|302817780|ref|XP_002990565.1| hypothetical protein SELMODRAFT_185367 [Selaginella moellendorffii] gi|300141733|gb|EFJ08442.1| hypothetical protein SELMODRAFT_185367 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
| >gi|393217224|gb|EJD02713.1| hypothetical protein FOMMEDRAFT_122741 [Fomitiporia mediterranea MF3/22] | Back alignment and taxonomy information |
|---|
| >gi|356562107|ref|XP_003549315.1| PREDICTED: uncharacterized protein LOC100779829 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|242094948|ref|XP_002437964.1| hypothetical protein SORBIDRAFT_10g005630 [Sorghum bicolor] gi|241916187|gb|EER89331.1| hypothetical protein SORBIDRAFT_10g005630 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|297802844|ref|XP_002869306.1| hypothetical protein ARALYDRAFT_328538 [Arabidopsis lyrata subsp. lyrata] gi|297315142|gb|EFH45565.1| hypothetical protein ARALYDRAFT_328538 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|321263641|ref|XP_003196538.1| helicase [Cryptococcus gattii WM276] gi|317463015|gb|ADV24751.1| Helicase, putative [Cryptococcus gattii WM276] | Back alignment and taxonomy information |
|---|
| >gi|405123404|gb|AFR98169.1| helicase [Cryptococcus neoformans var. grubii H99] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 169 | ||||||
| TAIR|locus:2040184 | 1384 | PKL "PICKLE" [Arabidopsis thal | 0.893 | 0.109 | 0.371 | 1.2e-19 | |
| UNIPROTKB|K7EMY3 | 1060 | CHD5 "Chromodomain-helicase-DN | 0.911 | 0.145 | 0.322 | 8.2e-17 | |
| UNIPROTKB|J9NRN3 | 1195 | CHD5 "Uncharacterized protein" | 0.911 | 0.128 | 0.322 | 9.6e-17 | |
| UNIPROTKB|F2Z2R5 | 1225 | CHD5 "Chromodomain-helicase-DN | 0.911 | 0.125 | 0.322 | 1e-16 | |
| UNIPROTKB|F1SSZ2 | 1667 | CHD5 "Uncharacterized protein" | 0.911 | 0.092 | 0.322 | 1.5e-16 | |
| UNIPROTKB|F1RIM3 | 1723 | CHD5 "Uncharacterized protein" | 0.911 | 0.089 | 0.322 | 1.5e-16 | |
| UNIPROTKB|E2R1M3 | 1812 | CHD5 "Uncharacterized protein" | 0.911 | 0.084 | 0.322 | 1.6e-16 | |
| UNIPROTKB|F1MFF9 | 1852 | Bt.62145 "Uncharacterized prot | 0.911 | 0.083 | 0.322 | 1.7e-16 | |
| UNIPROTKB|Q8TDI0 | 1954 | CHD5 "Chromodomain-helicase-DN | 0.911 | 0.078 | 0.322 | 1.8e-16 | |
| RGD|1582725 | 1940 | Chd5 "chromodomain helicase DN | 0.911 | 0.079 | 0.322 | 2.3e-16 |
| TAIR|locus:2040184 PKL "PICKLE" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 248 (92.4 bits), Expect = 1.2e-19, P = 1.2e-19
Identities = 59/159 (37%), Positives = 85/159 (53%)
Query: 4 VIPDPTRYRKSGKVIAFFCKIIEEQALEPNLIVCPLSVLNNWEAEFRKFAPFVRTVKYYG 63
++ D K+ + IA + EE + P+L++ PLS L NWE EF +AP + V Y+G
Sbjct: 295 ILADEMGLGKTIQSIALLASLFEENLI-PHLVIAPLSTLRNWEREFATWAPQMNVVMYFG 353
Query: 64 NAIERKALQSEA--LSLPTIKVPAKKG----KTKKQISLKLPLILVTTPQIIENDFGFLK 117
A R ++ LS K+ KK KQ +K +L+T+ ++I D LK
Sbjct: 354 TAQARAVIREHEFYLSKDQKKIKKKKSGQISSESKQKRIKFD-VLLTSYEMINLDSAVLK 412
Query: 118 KITWNCIIVDEGHSVKNKKSKLSIKLTALRATFKVLLTG 156
I W C+IVDEGH +KNK SKL LT + ++LLTG
Sbjct: 413 PIKWECMIVDEGHRLKNKDSKLFSSLTQYSSNHRILLTG 451
|
|
| UNIPROTKB|K7EMY3 CHD5 "Chromodomain-helicase-DNA-binding protein 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NRN3 CHD5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z2R5 CHD5 "Chromodomain-helicase-DNA-binding protein 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SSZ2 CHD5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RIM3 CHD5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R1M3 CHD5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MFF9 Bt.62145 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8TDI0 CHD5 "Chromodomain-helicase-DNA-binding protein 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1582725 Chd5 "chromodomain helicase DNA binding protein 5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 169 | |||
| pfam00176 | 301 | pfam00176, SNF2_N, SNF2 family N-terminal domain | 1e-22 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 9e-19 | |
| COG0553 | 866 | COG0553, HepA, Superfamily II DNA/RNA helicases, S | 2e-17 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 1e-10 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 5e-08 | |
| PRK13767 | 876 | PRK13767, PRK13767, ATP-dependent helicase; Provis | 1e-04 |
| >gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain | Back alignment and domain information |
|---|
Score = 91.3 bits (227), Expect = 1e-22
Identities = 49/150 (32%), Positives = 73/150 (48%), Gaps = 25/150 (16%)
Query: 15 GK---VIAFFCKIIEEQALE--PNLIVCPLSVLNNWEAEFRKFAPFVRTVKYYGNAIERK 69
GK IA ++E P L+VCPLS L+NW EF K+AP +R V Y+G+ ER
Sbjct: 28 GKTLQTIALLATYLKEGKDRRGPTLVVCPLSTLHNWLNEFEKWAPALRVVVYHGDGRERS 87
Query: 70 ALQSEALSLPTIKVPAKKGKTKKQISLKLPLILVTTPQIIENDF---GFLKKITWNCIIV 126
L+ K +++TT +++ D L K+ W+ +++
Sbjct: 88 KLRQS-----MAKRLDTYD------------VVITTYEVLRKDKKLLSLLNKVEWDRVVL 130
Query: 127 DEGHSVKNKKSKLSIKLTALRATFKVLLTG 156
DE H +KN KSKL L L+ ++LLTG
Sbjct: 131 DEAHRLKNSKSKLYKALKKLKTRNRLLLTG 160
|
This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g. ERCC6, RAD16, RAD5), DNA recombination (e.g. RAD54), and chromatin unwinding (e.g. ISWI) as well as a variety of other proteins with little functional information (e.g. lodestar, ETL1). Length = 301 |
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 169 | |||
| KOG0385|consensus | 971 | 100.0 | ||
| KOG0389|consensus | 941 | 100.0 | ||
| KOG0387|consensus | 923 | 100.0 | ||
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 100.0 | |
| KOG0391|consensus | 1958 | 100.0 | ||
| KOG0392|consensus | 1549 | 100.0 | ||
| KOG0388|consensus | 1185 | 100.0 | ||
| KOG0384|consensus | 1373 | 100.0 | ||
| KOG0386|consensus | 1157 | 100.0 | ||
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 100.0 | |
| KOG0390|consensus | 776 | 100.0 | ||
| KOG1002|consensus | 791 | 100.0 | ||
| KOG4439|consensus | 901 | 100.0 | ||
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 99.97 | |
| KOG1015|consensus | 1567 | 99.96 | ||
| KOG1000|consensus | 689 | 99.95 | ||
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 99.95 | |
| KOG1016|consensus | 1387 | 99.94 | ||
| KOG1001|consensus | 674 | 99.92 | ||
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 99.91 | |
| KOG0383|consensus | 696 | 99.89 | ||
| KOG0298|consensus | 1394 | 99.88 | ||
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 99.84 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 99.8 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 99.77 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.77 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.75 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 99.75 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 99.72 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 99.67 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 99.65 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.65 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 99.64 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 99.63 | |
| KOG1123|consensus | 776 | 99.61 | ||
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.59 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 99.57 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 99.57 | |
| KOG0354|consensus | 746 | 99.57 | ||
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.52 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.51 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.48 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.47 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.47 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.44 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.42 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.42 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.4 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 99.4 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.39 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.38 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.38 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.37 | |
| PTZ00110 | 545 | helicase; Provisional | 99.36 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 99.36 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.36 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 99.36 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.36 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.35 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.35 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.35 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.32 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.32 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.3 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.29 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.26 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.23 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 99.21 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.19 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.17 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.1 | |
| COG0610 | 962 | Type I site-specific restriction-modification syst | 99.09 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.08 | |
| PF13872 | 303 | AAA_34: P-loop containing NTP hydrolase pore-1 | 99.07 | |
| KOG0330|consensus | 476 | 99.04 | ||
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 99.02 | |
| KOG0331|consensus | 519 | 98.98 | ||
| PRK14701 | 1638 | reverse gyrase; Provisional | 98.95 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 98.92 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 98.89 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 98.89 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 98.88 | |
| KOG0952|consensus | 1230 | 98.85 | ||
| KOG0350|consensus | 620 | 98.82 | ||
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 98.82 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 98.81 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 98.8 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 98.75 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 98.75 | |
| KOG0338|consensus | 691 | 98.73 | ||
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 98.68 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 98.66 | |
| KOG0345|consensus | 567 | 98.64 | ||
| KOG0335|consensus | 482 | 98.62 | ||
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 98.6 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 98.59 | |
| COG3587 | 985 | Restriction endonuclease [Defense mechanisms] | 98.56 | |
| KOG0342|consensus | 543 | 98.47 | ||
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 98.47 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 98.46 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 98.45 | |
| KOG0347|consensus | 731 | 98.41 | ||
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 98.39 | |
| KOG0343|consensus | 758 | 98.38 | ||
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 98.37 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 98.37 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 98.36 | |
| KOG0348|consensus | 708 | 98.35 | ||
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 98.35 | |
| KOG4284|consensus | 980 | 98.33 | ||
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 98.33 | |
| KOG0353|consensus | 695 | 98.32 | ||
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 98.28 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 98.24 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 98.23 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 98.22 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 98.22 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 98.19 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.19 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 98.17 | |
| KOG1802|consensus | 935 | 98.15 | ||
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 98.15 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 98.15 | |
| KOG0346|consensus | 569 | 98.14 | ||
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 98.14 | |
| KOG1803|consensus | 649 | 98.13 | ||
| KOG0951|consensus | 1674 | 98.02 | ||
| KOG0339|consensus | 731 | 98.02 | ||
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 97.98 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 97.94 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.93 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 97.91 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 97.9 | |
| KOG0352|consensus | 641 | 97.85 | ||
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.84 | |
| KOG0328|consensus | 400 | 97.8 | ||
| KOG0949|consensus | 1330 | 97.79 | ||
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 97.75 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 97.73 | |
| KOG0337|consensus | 529 | 97.73 | ||
| KOG1513|consensus | 1300 | 97.71 | ||
| KOG0340|consensus | 442 | 97.71 | ||
| KOG0947|consensus | 1248 | 97.71 | ||
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.68 | |
| KOG0341|consensus | 610 | 97.67 | ||
| KOG1805|consensus | 1100 | 97.59 | ||
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 97.58 | |
| KOG1131|consensus | 755 | 97.56 | ||
| KOG0922|consensus | 674 | 97.55 | ||
| KOG0336|consensus | 629 | 97.54 | ||
| KOG0329|consensus | 387 | 97.53 | ||
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 97.52 | |
| COG3421 | 812 | Uncharacterized protein conserved in bacteria [Fun | 97.49 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 97.47 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 97.46 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 97.46 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 97.46 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 97.43 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 97.29 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 97.27 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 97.27 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.23 | |
| KOG0926|consensus | 1172 | 97.22 | ||
| PF13245 | 76 | AAA_19: Part of AAA domain | 97.18 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 97.16 | |
| KOG0351|consensus | 941 | 97.14 | ||
| KOG0948|consensus | 1041 | 97.14 | ||
| KOG0920|consensus | 924 | 97.12 | ||
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 97.09 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 97.05 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.04 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 97.02 | |
| KOG0334|consensus | 997 | 97.02 | ||
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 97.0 | |
| PRK06526 | 254 | transposase; Provisional | 96.98 | |
| KOG0344|consensus | 593 | 96.96 | ||
| KOG0333|consensus | 673 | 96.95 | ||
| KOG0332|consensus | 477 | 96.94 | ||
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.91 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 96.88 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 96.85 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.8 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 96.8 | |
| KOG0951|consensus | 1674 | 96.79 | ||
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 96.79 | |
| KOG0326|consensus | 459 | 96.74 | ||
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 96.74 | |
| KOG1132|consensus | 945 | 96.74 | ||
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 96.62 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 96.58 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.54 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.54 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 96.47 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.44 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 96.44 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 96.4 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.36 | |
| KOG0924|consensus | 1042 | 96.35 | ||
| PLN03025 | 319 | replication factor C subunit; Provisional | 96.3 | |
| PHA03368 | 738 | DNA packaging terminase subunit 1; Provisional | 96.3 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 96.2 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 96.17 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 96.16 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 96.15 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 96.06 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 96.04 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.03 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 96.03 | |
| KOG0327|consensus | 397 | 95.93 | ||
| PTZ00293 | 211 | thymidine kinase; Provisional | 95.92 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 95.9 | |
| KOG0925|consensus | 699 | 95.87 | ||
| KOG0989|consensus | 346 | 95.83 | ||
| CHL00181 | 287 | cbbX CbbX; Provisional | 95.81 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 95.78 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 95.73 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 95.71 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 95.65 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 95.64 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 95.61 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 95.61 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 95.6 | |
| PF06733 | 174 | DEAD_2: DEAD_2; InterPro: IPR010614 This represent | 95.58 | |
| PRK08181 | 269 | transposase; Validated | 95.57 | |
| KOG0923|consensus | 902 | 95.56 | ||
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 95.55 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 95.55 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 95.54 | |
| COG1435 | 201 | Tdk Thymidine kinase [Nucleotide transport and met | 95.54 | |
| PHA03372 | 668 | DNA packaging terminase subunit 1; Provisional | 95.48 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 95.45 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 95.37 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 95.37 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 95.34 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 95.3 | |
| KOG0952|consensus | 1230 | 95.27 | ||
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 95.23 | |
| PF07015 | 231 | VirC1: VirC1 protein; InterPro: IPR009744 This fam | 95.22 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 95.21 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 95.2 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 95.19 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.14 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 95.11 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 95.01 | |
| COG0653 | 822 | SecA Preprotein translocase subunit SecA (ATPase, | 94.99 | |
| KOG0780|consensus | 483 | 94.92 | ||
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 94.9 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 94.9 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 94.88 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 94.88 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 94.86 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 94.84 | |
| PHA03333 | 752 | putative ATPase subunit of terminase; Provisional | 94.81 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 94.81 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 94.65 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 94.64 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 94.6 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 94.57 | |
| KOG0950|consensus | 1008 | 94.54 | ||
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.5 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 94.4 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 94.36 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 94.33 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 94.24 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.21 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 94.2 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 94.18 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 94.11 | |
| KOG0991|consensus | 333 | 94.11 | ||
| PHA00012 | 361 | I assembly protein | 94.02 | |
| COG1702 | 348 | PhoH Phosphate starvation-inducible protein PhoH, | 94.01 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 94.0 | |
| PF12340 | 229 | DUF3638: Protein of unknown function (DUF3638); In | 94.0 | |
| PF05876 | 557 | Terminase_GpA: Phage terminase large subunit (GpA) | 93.97 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 93.97 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 93.96 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 93.94 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 93.93 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 93.9 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 93.78 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 93.77 | |
| PHA02533 | 534 | 17 large terminase protein; Provisional | 93.75 | |
| TIGR01547 | 396 | phage_term_2 phage terminase, large subunit, PBSX | 93.73 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 93.72 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 93.71 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 93.69 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 93.66 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 93.62 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 93.47 | |
| PF05127 | 177 | Helicase_RecD: Helicase; InterPro: IPR007807 This | 93.44 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 93.43 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 93.39 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 93.38 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 93.38 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 93.36 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 93.35 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 93.33 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 93.29 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 93.27 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 93.26 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 93.19 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 93.09 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 93.05 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 93.0 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 92.96 | |
| PF03237 | 384 | Terminase_6: Terminase-like family; InterPro: IPR0 | 92.9 | |
| COG2894 | 272 | MinD Septum formation inhibitor-activating ATPase | 92.88 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 92.82 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 92.78 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 92.75 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 92.72 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 92.71 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 92.7 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 92.57 | |
| PF02572 | 172 | CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase | 92.43 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 92.4 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 92.25 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.24 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 92.17 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 92.16 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 92.05 | |
| PHA00350 | 399 | putative assembly protein | 92.03 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 92.01 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 91.99 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 91.99 | |
| PRK12377 | 248 | putative replication protein; Provisional | 91.98 | |
| PF06564 | 243 | YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p | 91.87 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 91.85 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 91.83 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 91.78 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 91.77 | |
| KOG0739|consensus | 439 | 91.69 | ||
| PRK04328 | 249 | hypothetical protein; Provisional | 91.64 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 91.6 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 91.58 | |
| PHA00673 | 154 | acetyltransferase domain containing protein | 91.51 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 91.47 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 91.43 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 91.42 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 91.39 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 91.37 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 91.19 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 91.12 | |
| COG3265 | 161 | GntK Gluconate kinase [Carbohydrate transport and | 91.08 | |
| TIGR00347 | 166 | bioD dethiobiotin synthase. Dethiobiotin synthase | 91.07 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 91.03 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 90.96 | |
| TIGR00596 | 814 | rad1 DNA repair protein (rad1). This family is bas | 90.94 | |
| TIGR01281 | 268 | DPOR_bchL light-independent protochlorophyllide re | 90.81 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 90.77 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 90.77 | |
| TIGR00682 | 311 | lpxK tetraacyldisaccharide 4'-kinase. Also called | 90.65 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 90.65 | |
| PF02606 | 326 | LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr | 90.64 | |
| PRK13230 | 279 | nitrogenase reductase-like protein; Reviewed | 90.58 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 90.53 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 90.5 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 90.41 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 90.32 | |
| PF02456 | 369 | Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR | 90.29 | |
| PRK10037 | 250 | cell division protein; Provisional | 90.29 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 89.95 | |
| PF03354 | 477 | Terminase_1: Phage Terminase ; InterPro: IPR005021 | 89.92 | |
| PRK13185 | 270 | chlL protochlorophyllide reductase iron-sulfur ATP | 89.87 | |
| PHA02518 | 211 | ParA-like protein; Provisional | 89.84 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 89.81 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 89.73 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 89.53 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 89.51 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 89.4 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 89.39 | |
| CHL00072 | 290 | chlL photochlorophyllide reductase subunit L | 89.39 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 89.38 | |
| cd02032 | 267 | Bchl_like This family of proteins contains bchL an | 89.36 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 89.36 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 89.11 | |
| PRK13849 | 231 | putative crown gall tumor protein VirC1; Provision | 89.02 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 88.98 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 88.93 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 88.9 | |
| KOG1133|consensus | 821 | 88.88 | ||
| PF13500 | 199 | AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R | 88.81 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 88.76 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 88.73 | |
| KOG1807|consensus | 1025 | 88.72 | ||
| KOG0738|consensus | 491 | 88.68 | ||
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 88.68 | |
| PF13173 | 128 | AAA_14: AAA domain | 88.62 | |
| PRK00652 | 325 | lpxK tetraacyldisaccharide 4'-kinase; Reviewed | 88.61 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 88.58 | |
| COG2205 | 890 | KdpD Osmosensitive K+ channel histidine kinase [Si | 88.57 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 88.57 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 88.57 | |
| PRK10263 | 1355 | DNA translocase FtsK; Provisional | 88.51 | |
| PRK13232 | 273 | nifH nitrogenase reductase; Reviewed | 88.5 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 88.49 | |
| PF05729 | 166 | NACHT: NACHT domain | 88.33 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 88.24 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 88.19 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 88.05 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 88.0 | |
| TIGR01969 | 251 | minD_arch cell division ATPase MinD, archaeal. Thi | 87.92 | |
| PRK13236 | 296 | nitrogenase reductase; Reviewed | 87.89 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 87.88 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 87.78 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 87.67 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 87.54 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 87.28 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 87.21 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 87.13 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 87.1 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 87.0 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 86.93 | |
| PF00265 | 176 | TK: Thymidine kinase; InterPro: IPR001267 Thymidin | 86.77 | |
| COG1192 | 259 | Soj ATPases involved in chromosome partitioning [C | 86.73 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 86.61 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 86.59 | |
| KOG2825|consensus | 323 | 86.54 | ||
| PRK13695 | 174 | putative NTPase; Provisional | 86.51 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 86.44 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 86.29 | |
| PHA02519 | 387 | plasmid partition protein SopA; Reviewed | 86.23 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 85.96 | |
| PRK13234 | 295 | nifH nitrogenase reductase; Reviewed | 85.82 | |
| PRK13233 | 275 | nifH nitrogenase reductase; Reviewed | 85.79 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 85.78 | |
| PRK10818 | 270 | cell division inhibitor MinD; Provisional | 85.72 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 85.7 | |
| TIGR02016 | 296 | BchX chlorophyllide reductase iron protein subunit | 85.68 | |
| PRK13705 | 388 | plasmid-partitioning protein SopA; Provisional | 85.6 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 85.53 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 85.44 | |
| PRK13869 | 405 | plasmid-partitioning protein RepA; Provisional | 85.37 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 85.34 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 85.27 | |
| PRK00090 | 222 | bioD dithiobiotin synthetase; Reviewed | 85.22 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 85.2 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 85.19 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 85.11 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 85.1 | |
| cd02036 | 179 | MinD Bacterial cell division requires the formatio | 85.1 | |
| TIGR01007 | 204 | eps_fam capsular exopolysaccharide family. This mo | 84.92 | |
| PRK01906 | 338 | tetraacyldisaccharide 4'-kinase; Provisional | 84.86 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 84.62 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 84.43 | |
| TIGR03371 | 246 | cellulose_yhjQ cellulose synthase operon protein Y | 84.41 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 84.33 | |
| TIGR01968 | 261 | minD_bact septum site-determining protein MinD. Th | 83.58 | |
| KOG2028|consensus | 554 | 83.23 | ||
| PF02702 | 211 | KdpD: Osmosensitive K+ channel His kinase sensor d | 83.18 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 83.03 | |
| PRK07773 | 886 | replicative DNA helicase; Validated | 82.96 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 82.89 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 82.89 | |
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 82.85 | |
| COG1880 | 170 | CdhB CO dehydrogenase/acetyl-CoA synthase epsilon | 82.85 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 82.83 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 82.79 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 82.75 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 82.75 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 82.7 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 82.57 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 82.47 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 82.45 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 82.38 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 82.35 | |
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 82.3 | |
| KOG2543|consensus | 438 | 82.11 | ||
| PRK05595 | 444 | replicative DNA helicase; Provisional | 81.8 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 81.78 | |
| PRK13768 | 253 | GTPase; Provisional | 81.66 | |
| COG0305 | 435 | DnaB Replicative DNA helicase [DNA replication, re | 81.63 | |
| CHL00175 | 281 | minD septum-site determining protein; Validated | 81.14 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 80.83 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 80.53 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 80.47 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 80.29 | |
| cd03109 | 134 | DTBS Dethiobiotin synthetase (DTBS) is the penulti | 80.03 |
| >KOG0385|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-45 Score=286.24 Aligned_cols=151 Identities=30% Similarity=0.514 Sum_probs=142.8
Q ss_pred CCccccCCCCCcHHHHHHHHHHHHHHh-CCCCceEEEecCcchHHHHHHHHHhCCCceEEEEeCCHHHHHHHHHhhhcCC
Q psy1090 1 MDTVIPDPTRYRKSGKVIAFFCKIIEE-QALEPNLIVCPLSVLNNWEAEFRKFAPFVRTVKYYGNAIERKALQSEALSLP 79 (169)
Q Consensus 1 ~g~iL~de~G~GKT~~~i~~i~~~~~~-~~~~~~Liv~P~~~l~qW~~e~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~ 79 (169)
.|||||||||+|||+++|+++.++... +..+|.||+||.+++++|..||.+|+|+++++.|+|++.+|..........
T Consensus 187 ingILaDEMGLGKTlQtIs~l~yl~~~~~~~GPfLVi~P~StL~NW~~Ef~rf~P~l~~~~~~Gdk~eR~~~~r~~~~~- 265 (971)
T KOG0385|consen 187 INGILADEMGLGKTLQTISLLGYLKGRKGIPGPFLVIAPKSTLDNWMNEFKRFTPSLNVVVYHGDKEERAALRRDIMLP- 265 (971)
T ss_pred cccEeehhcccchHHHHHHHHHHHHHhcCCCCCeEEEeeHhhHHHHHHHHHHhCCCcceEEEeCCHHHHHHHHHHhhcc-
Confidence 479999999999999999999999884 668999999999999999999999999999999999999998888766542
Q ss_pred CcccccccCCccccccCCCCeEEEecHHHHHhchhccccccccEEEEeCCcccCCcccHHHHHHhccccccEEEEeccCC
Q psy1090 80 TIKVPAKKGKTKKQISLKLPLILVTTPQIIENDFGFLKKITWNCIIVDEGHSVKNKKSKLSIKLTALRATFKVLLTGWYY 159 (169)
Q Consensus 80 ~~~~~~~~~~~~~~~~~~~~ii~i~ty~~~~~~~~~~~~~~~~~vi~DEah~~k~~~~~~~~~~~~l~~~~~~~lT~TP~ 159 (169)
+.+++ ++|||+.+.++...+.+++|.++|+||||++||.+|+.++.++.+++.+|+++||||+
T Consensus 266 ----------------~~fdV-~iTsYEi~i~dk~~lk~~~W~ylvIDEaHRiKN~~s~L~~~lr~f~~~nrLLlTGTPL 328 (971)
T KOG0385|consen 266 ----------------GRFDV-CITSYEIAIKDKSFLKKFNWRYLVIDEAHRIKNEKSKLSKILREFKTDNRLLLTGTPL 328 (971)
T ss_pred ----------------CCCce-EeehHHHHHhhHHHHhcCCceEEEechhhhhcchhhHHHHHHHHhcccceeEeeCCcc
Confidence 68888 9999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCchhhccC
Q psy1090 160 PNKWSKQCTL 169 (169)
Q Consensus 160 ~n~~~el~~l 169 (169)
||++.|||+|
T Consensus 329 QNNL~ELWaL 338 (971)
T KOG0385|consen 329 QNNLHELWAL 338 (971)
T ss_pred cccHHHHHHH
Confidence 9999999986
|
|
| >KOG0389|consensus | Back alignment and domain information |
|---|
| >KOG0387|consensus | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG0391|consensus | Back alignment and domain information |
|---|
| >KOG0392|consensus | Back alignment and domain information |
|---|
| >KOG0388|consensus | Back alignment and domain information |
|---|
| >KOG0384|consensus | Back alignment and domain information |
|---|
| >KOG0386|consensus | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >KOG0390|consensus | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >KOG4439|consensus | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >KOG1015|consensus | Back alignment and domain information |
|---|
| >KOG1000|consensus | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1016|consensus | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >KOG0383|consensus | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >KOG1123|consensus | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >COG3587 Restriction endonuclease [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0353|consensus | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1802|consensus | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG1803|consensus | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >KOG0949|consensus | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >KOG0337|consensus | Back alignment and domain information |
|---|
| >KOG1513|consensus | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >KOG0947|consensus | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >KOG1805|consensus | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1131|consensus | Back alignment and domain information |
|---|
| >KOG0922|consensus | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >KOG0329|consensus | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >COG3421 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >KOG0926|consensus | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >KOG0351|consensus | Back alignment and domain information |
|---|
| >KOG0948|consensus | Back alignment and domain information |
|---|
| >KOG0920|consensus | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >KOG0332|consensus | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0326|consensus | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG1132|consensus | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0924|consensus | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PHA03368 DNA packaging terminase subunit 1; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >PTZ00293 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0925|consensus | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >KOG0923|consensus | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PHA03372 DNA packaging terminase subunit 1; Provisional | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0780|consensus | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PHA03333 putative ATPase subunit of terminase; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0950|consensus | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0991|consensus | Back alignment and domain information |
|---|
| >PHA00012 I assembly protein | Back alignment and domain information |
|---|
| >COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length | Back alignment and domain information |
|---|
| >PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PHA02533 17 large terminase protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] | Back alignment and domain information |
|---|
| >COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PHA00350 putative assembly protein | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0739|consensus | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA00673 acetyltransferase domain containing protein | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00347 bioD dethiobiotin synthase | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >TIGR00596 rad1 DNA repair protein (rad1) | Back alignment and domain information |
|---|
| >TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00682 lpxK tetraacyldisaccharide 4'-kinase | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability [] | Back alignment and domain information |
|---|
| >PRK13230 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] | Back alignment and domain information |
|---|
| >PRK10037 cell division protein; Provisional | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) | Back alignment and domain information |
|---|
| >PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PHA02518 ParA-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >CHL00072 chlL photochlorophyllide reductase subunit L | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd02032 Bchl_like This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13849 putative crown gall tumor protein VirC1; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >KOG1133|consensus | Back alignment and domain information |
|---|
| >PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG1807|consensus | Back alignment and domain information |
|---|
| >KOG0738|consensus | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >PRK10263 DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >PRK13232 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR01969 minD_arch cell division ATPase MinD, archaeal | Back alignment and domain information |
|---|
| >PRK13236 nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 | Back alignment and domain information |
|---|
| >COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >KOG2825|consensus | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PHA02519 plasmid partition protein SopA; Reviewed | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PRK13234 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13233 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PRK10818 cell division inhibitor MinD; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >TIGR02016 BchX chlorophyllide reductase iron protein subunit X | Back alignment and domain information |
|---|
| >PRK13705 plasmid-partitioning protein SopA; Provisional | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK13869 plasmid-partitioning protein RepA; Provisional | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK00090 bioD dithiobiotin synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >TIGR01007 eps_fam capsular exopolysaccharide family | Back alignment and domain information |
|---|
| >PRK01906 tetraacyldisaccharide 4'-kinase; Provisional | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >TIGR01968 minD_bact septum site-determining protein MinD | Back alignment and domain information |
|---|
| >KOG2028|consensus | Back alignment and domain information |
|---|
| >PF02702 KdpD: Osmosensitive K+ channel His kinase sensor domain; InterPro: IPR003852 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK07773 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >COG1880 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >KOG2543|consensus | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >CHL00175 minD septum-site determining protein; Validated | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 169 | ||||
| 1z6a_A | 500 | Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN | 1e-13 | ||
| 1z63_A | 500 | Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM | 1e-13 | ||
| 3mwy_W | 800 | Crystal Structure Of The Chromodomain-atpase Portio | 3e-11 |
| >pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 | Back alignment and structure |
|
| >pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 | Back alignment and structure |
| >pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 169 | |||
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 3e-38 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 1e-25 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 8e-25 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 4e-14 |
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 | Back alignment and structure |
|---|
Score = 137 bits (346), Expect = 3e-38
Identities = 42/146 (28%), Positives = 64/146 (43%), Gaps = 13/146 (8%)
Query: 15 GK---VIAFFCKIIEEQALE-PNLIVCPLSVLNNWEAEFRKFAPFVRTVKYYGNAIERKA 70
GK +AF +I + P++IV PLS + W F K+AP + + Y GN R
Sbjct: 267 GKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDT 326
Query: 71 LQSEALSLPTIKVPAKKGKTKKQISLKLPLILVTTPQIIENDFGFLKKITWNCIIVDEGH 130
++ K K +L+TT + I D L I W + VDE H
Sbjct: 327 IREYEFYTNPRAKGKKTMKFN---------VLLTTYEYILKDRAELGSIKWQFMAVDEAH 377
Query: 131 SVKNKKSKLSIKLTALRATFKVLLTG 156
+KN +S L L + + ++L+TG
Sbjct: 378 RLKNAESSLYESLNSFKVANRMLITG 403
|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 169 | |||
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 100.0 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 100.0 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 100.0 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 99.96 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.91 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 99.86 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.85 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 99.84 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.84 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.84 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.83 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.83 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.82 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.81 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.81 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.8 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 99.77 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.77 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 99.75 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 99.75 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.74 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 99.74 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.73 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 99.72 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 99.72 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.72 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 99.72 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 99.71 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 99.71 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 99.7 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.69 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 99.69 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.69 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.68 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.68 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.67 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.67 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.66 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 99.66 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 99.66 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.62 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 99.62 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 99.62 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.61 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.6 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.59 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.59 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.53 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.52 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.52 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.52 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.51 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.5 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.49 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.48 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.48 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.48 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.46 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.45 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.44 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.31 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.31 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.19 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.13 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.11 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.07 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.04 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 99.04 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.03 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.0 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 98.97 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 98.78 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 98.76 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 98.57 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 98.56 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 98.54 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 98.44 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 98.43 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 98.39 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 98.14 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 98.01 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 97.95 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 97.8 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 97.77 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 97.76 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 97.74 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 97.73 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 97.63 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 97.54 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 97.53 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 97.5 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 97.48 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 97.31 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 97.21 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 96.85 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.85 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 96.8 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 96.59 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 96.57 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.52 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 96.52 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 96.44 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 96.4 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 96.28 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 96.06 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 95.98 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 95.55 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 95.39 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 95.24 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 95.18 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 94.93 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 94.83 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 94.54 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 94.52 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 94.37 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 94.27 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 94.03 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 93.6 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 93.6 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 93.23 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 93.19 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 93.12 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 92.85 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 92.72 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 92.69 | |
| 3hjh_A | 483 | Transcription-repair-coupling factor; MFD, mutatio | 92.68 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 92.64 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 92.48 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 92.06 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 91.89 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 91.78 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 91.69 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 91.17 | |
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 91.02 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 91.01 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 90.98 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 90.09 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 90.08 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 89.86 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 89.8 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 89.56 | |
| 3u4q_B | 1166 | ATP-dependent helicase/deoxyribonuclease subunit; | 89.53 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 88.92 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 88.66 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 88.54 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 88.45 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 87.99 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 87.93 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 87.65 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 87.64 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 87.55 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 87.51 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 87.32 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 87.17 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 87.15 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 87.13 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 87.13 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 87.13 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 87.1 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 87.09 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 86.66 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 86.61 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 86.42 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 86.38 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 86.08 | |
| 3of5_A | 228 | Dethiobiotin synthetase; structural genomics, cent | 86.07 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 85.93 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 85.86 | |
| 3qxc_A | 242 | Dethiobiotin synthetase; DTBS, structural genomics | 85.85 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 85.75 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 85.66 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 85.64 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 85.15 | |
| 1wcv_1 | 257 | SOJ, segregation protein; ATPase, bacterial, chrom | 84.93 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 84.78 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 84.73 | |
| 3fgn_A | 251 | Dethiobiotin synthetase; biotin biosynthesis, BIOD | 84.19 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 83.94 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 83.91 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 83.82 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 83.54 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 83.17 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 83.02 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 82.81 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 82.72 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 82.65 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 82.2 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 82.14 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 82.07 | |
| 3pg5_A | 361 | Uncharacterized protein; structural genomics, PSI- | 81.21 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 81.06 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 81.05 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 80.96 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 80.73 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 80.14 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 80.07 |
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-37 Score=254.33 Aligned_cols=160 Identities=28% Similarity=0.434 Sum_probs=138.2
Q ss_pred CCccccCCCCCcHHHHHHHHHHHHHHh-CCCCceEEEecCcchHHHHHHHHHhCCCceEEEEeCCHHHHHHHHHhhhcCC
Q psy1090 1 MDTVIPDPTRYRKSGKVIAFFCKIIEE-QALEPNLIVCPLSVLNNWEAEFRKFAPFVRTVKYYGNAIERKALQSEALSLP 79 (169)
Q Consensus 1 ~g~iL~de~G~GKT~~~i~~i~~~~~~-~~~~~~Liv~P~~~l~qW~~e~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~ 79 (169)
.||||+|+||+|||+++++++..+... ...+|+|||||.+++.||.+|+.+|+|++++..++|....+..+....+...
T Consensus 256 ~~~ILademGlGKT~~ai~~i~~l~~~~~~~~~~LIV~P~sll~qW~~E~~~~~p~~~v~~~~g~~~~r~~~~~~~~~~~ 335 (800)
T 3mwy_W 256 DNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTN 335 (800)
T ss_dssp CCEEECCCTTSSTTHHHHHHHHHHHHHHSCCSCEEEECCTTTHHHHHHHHHHHSTTCCEEECCCSSHHHHHHHHHHSCSC
T ss_pred CCEEEEeCCCcchHHHHHHHHHHHHHhcCCCCCEEEEECchHHHHHHHHHHHHCCCceEEEEeCCHHHHHHHHHHHhhcc
Confidence 379999999999999999999877644 5568999999999999999999999999999999999988877666554321
Q ss_pred CcccccccCCccccccCCCCeEEEecHHHHHhchhccccccccEEEEeCCcccCCcccHHHHHHhccccccEEEEeccCC
Q psy1090 80 TIKVPAKKGKTKKQISLKLPLILVTTPQIIENDFGFLKKITWNCIIVDEGHSVKNKKSKLSIKLTALRATFKVLLTGWYY 159 (169)
Q Consensus 80 ~~~~~~~~~~~~~~~~~~~~ii~i~ty~~~~~~~~~~~~~~~~~vi~DEah~~k~~~~~~~~~~~~l~~~~~~~lT~TP~ 159 (169)
.. ........+++ +++||+.+.++...+....|++||+||||++||..++.++++..+++++||+|||||+
T Consensus 336 ~~--------~~~~~~~~~dv-vitTy~~l~~~~~~l~~~~w~~vIvDEaH~lkn~~s~~~~~l~~l~~~~rl~LTgTPi 406 (800)
T 3mwy_W 336 PR--------AKGKKTMKFNV-LLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPL 406 (800)
T ss_dssp C-------------CCCCCSE-EEECTTHHHHTHHHHHTSEEEEEEETTGGGGCCSSSHHHHHHTTSEEEEEEEECSCCC
T ss_pred cc--------ccccccccCCE-EEecHHHHHhhHHHHhcCCcceeehhhhhhhcCchhHHHHHHHHhhhccEEEeeCCcC
Confidence 11 01112256788 9999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCchhhccC
Q psy1090 160 PNKWSKQCTL 169 (169)
Q Consensus 160 ~n~~~el~~l 169 (169)
+|++.|||+|
T Consensus 407 qN~l~el~~l 416 (800)
T 3mwy_W 407 QNNIKELAAL 416 (800)
T ss_dssp SSCSHHHHHH
T ss_pred CCCHHHHHHH
Confidence 9999999974
|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A | Back alignment and structure |
|---|
| >1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 169 | ||||
| d1z63a1 | 230 | c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h | 0.001 | |
| d1z3ix2 | 298 | c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis | 0.001 |
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Helicase of the SNF2/Rad54 hamily species: Sulfolobus solfataricus [TaxId: 2287]
Score = 35.8 bits (81), Expect = 0.001
Identities = 41/144 (28%), Positives = 72/144 (50%), Gaps = 27/144 (18%)
Query: 13 KSGKVIAFFCKIIEEQALEPNLIVCPLSVLNNWEAEFRKFAPFVRTVKYYGNAIERKALQ 72
K+ + IA F +E L P+L++CPLSVL NWE E KFAP +R ++ + + K
Sbjct: 44 KTLQTIAVFSDAKKENELTPSLVICPLSVLKNWEEELSKFAPHLRFAVFHEDRSKIKLED 103
Query: 73 SEALSLPTIKVPAKKGKTKKQISLKLPLILVTTPQIIENDFGFLKKITWNCIIVDEGHSV 132
+ I++TT ++ D LK++ W I++DE ++
Sbjct: 104 YD--------------------------IILTTYAVLLRDTR-LKEVEWKYIVIDEAQNI 136
Query: 133 KNKKSKLSIKLTALRATFKVLLTG 156
KN ++K+ + L++ +++ LTG
Sbjct: 137 KNPQTKIFKAVKELKSKYRIALTG 160
|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 169 | |||
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 100.0 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 100.0 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.89 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 99.86 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.82 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.77 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.77 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.75 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 99.69 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.67 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.66 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.52 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.48 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.4 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.39 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.38 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 99.33 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 99.27 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 99.27 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.22 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.21 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 98.97 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 97.88 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 97.68 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 97.66 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 96.68 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 96.38 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 96.07 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 95.8 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 95.63 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 95.49 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 95.4 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 95.33 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 94.79 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 94.76 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 94.37 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 94.36 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 94.08 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 94.04 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 94.0 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 93.7 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 93.58 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.48 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 93.33 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 93.25 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 92.84 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 92.79 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 92.64 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 92.3 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 92.14 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 91.5 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 90.81 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 90.63 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 90.5 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 90.35 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 89.87 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 89.87 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 88.38 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 87.94 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 87.85 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 87.79 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 86.06 | |
| d2b2na1 | 308 | Transcription-repair coupling factor, TRCF {Escher | 85.91 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 85.69 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 85.24 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 84.58 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 84.42 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 84.42 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 83.9 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 83.73 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 83.51 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 83.15 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 82.8 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 82.57 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 82.54 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 82.34 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 81.91 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 81.6 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 81.24 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 80.48 |
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Rad54-like, Rad54L species: Zebra fish (Danio rerio) [TaxId: 7955]
Probab=100.00 E-value=2.1e-40 Score=242.26 Aligned_cols=155 Identities=20% Similarity=0.322 Sum_probs=126.0
Q ss_pred CccccCCCCCcHHHHHHHHHHHHHHhCC-----CCceEEEecCcchHHHHHHHHHhCCC-ceEEEEeCCHHHHHHHHHhh
Q psy1090 2 DTVIPDPTRYRKSGKVIAFFCKIIEEQA-----LEPNLIVCPLSVLNNWEAEFRKFAPF-VRTVKYYGNAIERKALQSEA 75 (169)
Q Consensus 2 g~iL~de~G~GKT~~~i~~i~~~~~~~~-----~~~~Liv~P~~~l~qW~~e~~~~~~~-~~~~~~~g~~~~~~~~~~~~ 75 (169)
|||||||||+|||+++|+++..+..... .+++|||||.+++.||.+|+.+|++. ...+.+++..+.+.......
T Consensus 81 g~iLaDemGlGKT~qaia~l~~l~~~~~~~~~~~~~~LIV~P~sl~~qW~~Ei~k~~~~~~~~v~~~~~~~~~~~~~~~~ 160 (298)
T d1z3ix2 81 GCIMADEMGLGKTLQCITLIWTLLKQSPDCKPEIDKVIVVSPSSLVRNWYNEVGKWLGGRVQPVAIDGGSKDEIDSKLVN 160 (298)
T ss_dssp EEEECCCTTSCHHHHHHHHHHHHHHCCTTSSCSCSCEEEEECHHHHHHHHHHHHHHHGGGCCEEEECSSCHHHHHHHHHH
T ss_pred ceEEEeCCCCCHHHHHHHHHHHHHHhcccccCCCCcEEEEccchhhHHHHHHHHhhcCCceeEEEEeCchHHHHHHHHHH
Confidence 7999999999999999999988877643 34699999999999999999999863 55666666544433222222
Q ss_pred hcCCCcccccccCCccccccCCCCeEEEecHHHHHhchhccccccccEEEEeCCcccCCcccHHHHHHhccccccEEEEe
Q psy1090 76 LSLPTIKVPAKKGKTKKQISLKLPLILVTTPQIIENDFGFLKKITWNCIIVDEGHSVKNKKSKLSIKLTALRATFKVLLT 155 (169)
Q Consensus 76 ~~~~~~~~~~~~~~~~~~~~~~~~ii~i~ty~~~~~~~~~~~~~~~~~vi~DEah~~k~~~~~~~~~~~~l~~~~~~~lT 155 (169)
..... ......++ ++++|+.+.++.+.+...+|+++|+||+|+++|.+++.++++..++++++|+||
T Consensus 161 ~~~~~------------~~~~~~~v-~i~sy~~~~~~~~~l~~~~~~~vI~DEaH~ikn~~s~~~~a~~~l~~~~rllLT 227 (298)
T d1z3ix2 161 FISQQ------------GMRIPTPI-LIISYETFRLHAEVLHKGKVGLVICDEGHRLKNSDNQTYLALNSMNAQRRVLIS 227 (298)
T ss_dssp HHCCC------------SSCCSCCE-EEEEHHHHHHHTTTTTTSCCCEEEETTGGGCCTTCHHHHHHHHHHCCSEEEEEC
T ss_pred hhhcc------------CccccceE-EEEeecccccchhcccccceeeeecccccccccccchhhhhhhccccceeeeec
Confidence 11100 00134456 999999999999999999999999999999999999999999999999999999
Q ss_pred ccCCCCCchhhccC
Q psy1090 156 GWYYPNKWSKQCTL 169 (169)
Q Consensus 156 ~TP~~n~~~el~~l 169 (169)
|||++|++.|||++
T Consensus 228 GTPi~N~~~dl~~l 241 (298)
T d1z3ix2 228 GTPIQNDLLEYFSL 241 (298)
T ss_dssp SSCSGGGGGGCHHH
T ss_pred chHHhhhhHHHHHH
Confidence 99999999999974
|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b2na1 c.37.1.19 (A:26-333) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|