Diaphorina citri psyllid: psy10918

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------

IPETRLTLGRSLNPDHIKEDSDVYFDCDIVAVPPVYKVEWRHNNKTLHHNIAQGIIMTNQSLVLQRVNRQSAGNYTCVGFNIEGDGESNAFFLNVMYSPTCKPHQQRVLGVARQEKVNISCEVDANPPDVKFSWTFNNSAETVNVAQAHILRSGTLSVVAYSPNSELDYGTLICWGSNKIGHQRVPCVFHIVSAVTFHPPFNQKLTR

ccEEEEccccccccccccccccEEEEEEEcccccccEEEEEEccEEccccccEEEEEcccEEEEccccccccCEEEEEEECccccccccEEEEEEEEccEEcccccCEEEEEccccEEEEEEEcccccccEEEEEEccCEEEcccccEEEEEcccEEEEEEEcccccccCEEEEEEECcccccCCcEEEEEEcccccccccCEEEcc

IPETRLTL***L****IKEDSDVYFDCDIVAVPPVYKVEWRHNNKTLHHNIAQGIIMTNQSLVLQRVNRQSAGNYTCVGFNIEGDGESNAFFLNVMYSPTCKPHQQRVLGVARQEKVNISCEVDANPPDVKFSWTFNNSAETVNVAQAHILRSGTLSVVAYSPNSELDYGTLICWGSNKIGHQRVPCVFHIVSAVTFHPPFNQKL**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005509 [MF]	calcium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0000794 [CC]	condensed nuclear chromosome	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0005865 [CC]	striated muscle thin filament	probable	GO:0036379, GO:0044446, GO:0043228, GO:0015629, GO:0043232, GO:0005856, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0030016, GO:0030017, GO:0043229, GO:0044430, GO:0043292, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044422, GO:0044449
GO:0004674 [MF]	protein serine/threonine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0043621 [MF]	protein self-association	probable	GO:0003674, GO:0005488, GO:0005515
GO:0030018 [CC]	Z disc	probable	GO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051592 [BP]	response to calcium ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051015 [MF]	actin filament binding	probable	GO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 13-193
View the alignment between query and template
View the model in PyMOL