Diaphorina citri psyllid: psy10937

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-

MNKIQVGAAPSPNLKKVTSKIGSLQNAHYKPGGGKVKIENRKLEWKAEPRIAAKNDEYVPGGGDKKIEVVKLNWNAKPKVGSLDNATHKPGGGDKKIESVKLDFKDKAKPKVGSKDNLKHSPGGGTVKVLP

cccEEEECccccccccccccccccccccccccccEEEEEEEEccccccccccccccCECccccCEEEEEEEcccccccccccccccccccccccEEEEEEEEccccccccccccccccccccccccEEEcc

*************************************IE*****W************YVPGGGDKKIEVVKLNWNA********************IESVKLDFKDKA***********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNKIQVGAAPSPNLKKVTSKIGSLQNAHYKPGGGKVKIENRKLEWKAEPRIAAKNDEYVPGGGDKKIEVVKLNWNAKPKVGSLDNATHKPGGGDKKIESVKLDFKDKAKPKVGSKDNLKHSPGGGTVKVLP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Microtubule-associated protein 2	The exact function of MAP2 is unknown but MAPs may stabilize the microtubules against depolymerization. They also seem to have a stiffening effect on microtubules.	confident	P15146

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005791 [CC]	rough endoplasmic reticulum	probable	GO:0005737, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0005790 [CC]	smooth endoplasmic reticulum	probable	GO:0005737, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0010033 [BP]	response to organic substance	probable	GO:0042221, GO:0050896, GO:0008150
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0044430 [CC]	cytoskeletal part	probable	GO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0008017 [MF]	microtubule binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0044463 [CC]	cell projection part	probable	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0046785 [BP]	microtubule polymerization	probable	GO:0006996, GO:0051258, GO:0007017, GO:0007010, GO:0071822, GO:0070271, GO:0043933, GO:0008150, GO:0006461, GO:0031109, GO:0065003, GO:0044085, GO:0000226, GO:0016043, GO:0034622, GO:0071840, GO:0044763, GO:0009987, GO:0043623, GO:0022607, GO:0044699
GO:0034399 [CC]	nuclear periphery	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0008355 [BP]	olfactory learning	probable	GO:0032501, GO:0007635, GO:0044707, GO:0042048, GO:0044708, GO:0050896, GO:0007612, GO:0007610, GO:0007611, GO:0008306, GO:0008150, GO:0050890, GO:0050877, GO:0042221, GO:0044699, GO:0003008
GO:0072375 [BP]	medium-term memory	probable	GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007613, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0015630 [CC]	microtubule cytoskeleton	probable	GO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted