Diaphorina citri psyllid: psy10947


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MDPSVLAAMDKDALKKQIENMKYQATMERWPLSKSIQAYLVPTFISHIGTLNSTYGIFKCIHRSNGAMDPSVLAAMDKDALKKQIENMKYQATMERWPLSKSIQAMREYVEENEKNDPLIHAPDKKNNPWAEKGKCSIM
ccHHHHHHHcHHHHHHHHHccHHHHHcccccccccccHHHHcEEEEcccccccccccccccccccccccHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccc
****V***MDKDALKKQIENMKYQATMERWPLSKSIQAYLVPTFISHIGTLNSTYGIFKCIH*********************QIENMKYQATMERWPLSKSIQAMREYVEENEKNDPLIHAPDK***PWAEKGKCSIM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPSVLAAMDKDALKKQIENMKYQATMERWPLSKSIQAYLVPTFISHIGTLNSTYGIFKCIHRSNGAMDPSVLAAMDKDALKKQIENMKYQATMERWPLSKSIQAMREYVEENEKNDPLIHAPDKKNNPWAEKGKCSIM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Guanine nucleotide-binding protein subunit gamma-e Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. This subunit functions in visual transduction in the compound eye.confidentQ9NFZ3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016028 [CC]rhabdomereprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0071244 [BP]cellular response to carbon dioxideprobableGO:1901700, GO:1901701, GO:0051716, GO:0050896, GO:0009987, GO:0071241, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0010037, GO:0010035, GO:0010033, GO:0044699
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0007602 [BP]phototransductionprobableGO:0044700, GO:0051716, GO:0009583, GO:0051606, GO:0009605, GO:0009581, GO:0009314, GO:0050896, GO:0009987, GO:0044763, GO:0009582, GO:0050794, GO:0008150, GO:0065007, GO:0009416, GO:0007165, GO:0023052, GO:0007154, GO:0009628, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GOT, chain G
Confidence level:very confident
Coverage over the Query: 77-132
View the alignment between query and template
View the model in PyMOL
Template: 1GOT, chain G
Confidence level:very confident
Coverage over the Query: 9-43
View the alignment between query and template
View the model in PyMOL
Template: 2PBI, chain A
Confidence level:confident
Coverage over the Query: 19-133
View the alignment between query and template
View the model in PyMOL