Diaphorina citri psyllid: psy10956


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580--
MKTNKPKARSSSESRIAAERLASYREESSTALLNSDSSRSDEYGYFEDMPEKDNKKCGVDVKKTVTVKHPESNKPKPTTKKKEPIQADLNIEKEFLRCKEENILNLDLSKSSITHLPPSVEKLTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRHNKLNELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIRELPPELGELKNLVTLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLESVPETLSKCVHLNEFNVEGCALSSLPDGLLSSLTSINNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLTELNLGTNQISKLSEDIQNLVNLEVLVLSNNLLKKLPSSIGNLRKLKCLDLEENKLESLPNEIGFLKELQRLILQSNQLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLHTLYLNDNTCLNNIPFELALCSNLQIMSLDNCPLSQIPSEIVVGGPSLIIRYLKMQGPYRTM
ccccccccccccHHHHHHHHHHccHHHHHHHHcccccccccccccccccccccccccccccccCEECcccccccccccccccccccccccccHHHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEcccccccccccHHcccccccEEEccccccccccHHHcccccccEEcccccccccccHHHcccccccEEcccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHccccccEEcccccccccccHHHHccccccccccccccccccccHHHHccccccEEEccccccccccHHHHHcccEEcccccccccccccc
*******************************************************KCGVDVKKTVTVKH********************NIEKEFLRCKEENILNLDLSKSSITHLPPSVEKLTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRHNKLNELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIRELPPELGELKNLVTLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLESVPETLSKCVHLNEFNVEGCALSSLPDGLLSSLTSINNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLTELNLGTNQISKLSEDIQNLVNLEVLVLSNNLLKKLPSSIGNLRKLKCLDLEENKLESLPNEIGFLKELQRLILQSNQLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLHTLYLNDNTCLNNIPFELALCSNLQIMSLDNCPLSQIPSEIVVGGPSLIIRYLKMQGPYR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTNKPKARSSSESRIAAERLASYREESSTALLNSDSSRSDEYGYFEDMPEKDNKKCGVDVKKTVTVKHPESNKPKPTTKKKEPIQADLNIEKEFLRCKEENILNLDLSKSSITHLPPSVEKLTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRHNKLNELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIRELPPELGELKNLVTLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLESVPETLSKCVHLNEFNVEGCALSSLPDGLLSSLTSINNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLTELNLGTNQISKLSEDIQNLVNLEVLVLSNNLLKKLPSSIGNLRKLKCLDLEENKLESLPNEIGFLKELQRLILQSNQLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLHTLYLNDNTCLNNIPFELALCSNLQIMSLDNCPLSQIPSEIVVGGPSLIIRYLKMQGPYRTM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Leucine-rich repeat protein SHOC-2 Regulatory subunit of protein phosphatase 1 (PP1c) that acts as a M-Ras/MRAS effector and participates in MAPK pathway activation. Upon M-Ras/MRAS activation, targets PP1c to specifically dephosphorylate the 'Ser-259' inhibitory site of RAF1 kinase and stimulate RAF1 activity at specialized signaling complexes.very confidentO88520
Leucine-rich repeat protein SHOC-2 Regulatory subunit of protein phosphatase 1 (PP1c) that acts as a M-Ras/MRAS effector and participates in MAPK pathway activation. Upon M-Ras/MRAS activation, targets PP1c to specifically dephosphorylate the 'Ser-259' inhibitory site of RAF1 kinase and stimulate RAF1 activity at specialized signaling complexes.very confidentQ6AYI5
Leucine-rich repeat protein SHOC-2 Regulatory subunit of protein phosphatase 1 (PP1c) that acts as a M-Ras/MRAS effector and participates in MAPK pathway activation. Upon M-Ras/MRAS activation, targets PP1c to specifically dephosphorylate the 'Ser-259' inhibitory site of RAF1 kinase and stimulate RAF1 activity at specialized signaling complexes.very confidentQ5RAV5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000164 [CC]protein phosphatase type 1 complexconfidentGO:0005737, GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0019903 [MF]protein phosphatase bindingconfidentGO:0019902, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0046579 [BP]positive regulation of Ras protein signal transductionconfidentGO:0051057, GO:0051056, GO:0009966, GO:0009967, GO:0048584, GO:0046578, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0007517 [BP]muscle organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0019888 [MF]protein phosphatase regulator activityprobableGO:0019208, GO:0003674, GO:0030234
GO:0031344 [BP]regulation of cell projection organizationprobableGO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051128
GO:0008543 [BP]fibroblast growth factor receptor signaling pathwayprobableGO:0007166, GO:0007167, GO:0070848, GO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0007169, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0044344, GO:0071310, GO:0065007, GO:0071495, GO:0009987, GO:0050794, GO:0044763, GO:0007154, GO:0010033, GO:0044700, GO:0071363, GO:0050896, GO:0071774, GO:0008150
GO:0040025 [BP]vulval developmentprobableGO:0032502, GO:0009791, GO:0048856, GO:0044707, GO:0048569, GO:0032501, GO:0002119, GO:0044767, GO:0048513, GO:0002164, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0017016 [MF]Ras GTPase bindingprobableGO:0019899, GO:0031267, GO:0051020, GO:0003674, GO:0005488, GO:0005515
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007265 [BP]Ras protein signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0007264, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2O6R, chain A
Confidence level:very confident
Coverage over the Query: 429-555
View the alignment between query and template
View the model in PyMOL
Template: 2O6S, chain A
Confidence level:very confident
Coverage over the Query: 394-495
View the alignment between query and template
View the model in PyMOL
Template: 2O6S, chain A
Confidence level:very confident
Coverage over the Query: 243-346
View the alignment between query and template
View the model in PyMOL
Template: 3G39, chain A
Confidence level:very confident
Coverage over the Query: 103-206
View the alignment between query and template
View the model in PyMOL
Template: 1XKU, chain A
Confidence level:very confident
Coverage over the Query: 240-326,351-549
View the alignment between query and template
View the model in PyMOL
Template: 1XKU, chain A
Confidence level:very confident
Coverage over the Query: 102-387
View the alignment between query and template
View the model in PyMOL
Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 101-571
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 49-77,91-345,370-484
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 26-72,101-403,419-531
View the alignment between query and template
View the model in PyMOL