Psyllid ID: psy10956

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580--
MKTNKPKARSSSESRIAAERLASYREESSTALLNSDSSRSDEYGYFEDMPEKDNKKCGVDVKKTVTVKHPESNKPKPTTKKKEPIQADLNIEKEFLRCKEENILNLDLSKSSITHLPPSVEKLTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRHNKLNELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIRELPPELGELKNLVTLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLESVPETLSKCVHLNEFNVEGCALSSLPDGLLSSLTSINNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLTELNLGTNQISKLSEDIQNLVNLEVLVLSNNLLKKLPSSIGNLRKLKCLDLEENKLESLPNEIGFLKELQRLILQSNQLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLHTLYLNDNTCLNNIPFELALCSNLQIMSLDNCPLSQIPSEIVVGGPSLIIRYLKMQGPYRTM
ccccccccccccHHHHHHHHHHccHHHHHHHHcccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccHHHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHcccccccEEcccccccccccHHHHccccccEEcccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHccccccEEcccccccccccHHHHccccccccccccccccccccHHHHccccccEEEcccccccccHHHHHHcccEEcccccccccccccc
ccccccccccccHHHHccccccccccHHHHHHHHccccccccccccHHHccHHHHHHHHHHHcccccccccccccccHHHHHccccccccccHHHccccccccEEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHcccccccEEEccccccccccccHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccccccccccccEEEccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEccccccccccHHHcccccccEEEcccccccccHHHHcccccccEEEEcccccccccHHHHccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEccccccccccHHHHHccccEEccccccccccccc
mktnkpkarssseSRIAAERLASYREESStallnsdssrsdeygyfedmpekdnkkcgvdvkktvtvkhpesnkpkpttkkkepiqADLNIEKEFLRckeenilnldlskssithlppsvekltHLEELYLYGNklaslpsqigyvtnltclglaensltslPDSLANLQQLRVLDLRHNKLNELPMVVYKLTSLKILYLRFNriktvhpdiqylsnlsmlsmrdnkirelppelgelknlVTLDLAHNHLeelpkeignCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLsynrlesvpetlskcvhlnefnvegcalsslpdgllssltsinnitlsrnkftaypsggptqftSVYSINfehnqidkipygifsraknlskvnmkdnlltslpldlgtwvgltelnlgtnQISKLSEDIQNLVNLEVLVLSNNLLkklpssignlrklkcldleenkleslpneIGFLKELQRLILQSNQLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLhtlylndntclnnIPFELALCSNlqimsldncplsqipseivvgGPSLIIRYLKmqgpyrtm
mktnkpkarsssesriAAERLAsyreesstallnsdssrsdEYGYFEdmpekdnkkcgvDVKKtvtvkhpesnkpkpttkkkepiqaDLNIEKEFLRCKEENILnldlskssithLPPSVEKLTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRHNKLNELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIRELPPELGELKNLVTLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLESVPETLSKCVHLNEFNVEGCALSSLPDGLLSSLTSINNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLTELNLGTNQISKLSEDIQNLVNLEVLVLSNNLLkklpssignlrkLKCLDLEENKLESLPNEIGFLKELQRLILQSNQLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLHTLYLNDNTCLNNIPFELALCSNLQIMSLDNCPLSQIPSEIVVGGPSLIIRylkmqgpyrtm
MKTNKPKarsssesriaaerlasYREESSTALLNSDSSRSDEYGYFEDMPEKDNKKCGVDVKKTVTVKHPESNkpkpttkkkEPIQADLNIEKEFLRCKEENILNLDLSKSSITHLPPSVEKLTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRHNKLNELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIRELPPELGELKNLVTLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLESVPETLSKCVHLNEFNVEGCAlsslpdgllssltsINNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLTELNLGTNQISKLSEDIQnlvnlevlvlsnnllkklPSSIGNLRKLKCLDLEENKLESLPNEIGFLKELQRLILQSNQLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLHTLYLNDNTCLNNIPFELALCSNLQIMSLDNCPLSQIPSEIVVGGPSLIIRYLKMQGPYRTM
*****************************************************************************************NIEKEFLRCKEENILNLDLSKSSITHLPPSVEKLTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRHNKLNELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIRELPPELGELKNLVTLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLESVPETLSKCVHLNEFNVEGCALSSLPDGLLSSLTSINNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLTELNLGTNQISKLSEDIQNLVNLEVLVLSNNLLKKLPSSIGNLRKLKCLDLEENKLESLPNEIGFLKELQRLILQSNQLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLHTLYLNDNTCLNNIPFELALCSNLQIMSLDNCPLSQIPSEIVVGGPSLIIRYLKM*******
*******************************************************KCGVDVKKTVTVKH********************NIEKEFLRCKEENILNLDLSKSSITHLPPSVEKLTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRHNKLNELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIRELPPELGELKNLVTLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLESVPETLSKCVHLNEFNVEGCALSSLPDGLLSSLTSINNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLTELNLGTNQISKLSEDIQNLVNLEVLVLSNNLLKKLPSSIGNLRKLKCLDLEENKLESLPNEIGFLKELQRLILQSNQLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLHTLYLNDNTCLNNIPFELALCSNLQIMSLDNCPLSQIPSEIVVGGPSLIIRYLKMQGPYR**
****************AAER*******************SDEYGYFEDMPEKDNKKCGVDVKKTVTVKH**************PIQADLNIEKEFLRCKEENILNLDLSKSSITHLPPSVEKLTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRHNKLNELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIRELPPELGELKNLVTLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLESVPETLSKCVHLNEFNVEGCALSSLPDGLLSSLTSINNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLTELNLGTNQISKLSEDIQNLVNLEVLVLSNNLLKKLPSSIGNLRKLKCLDLEENKLESLPNEIGFLKELQRLILQSNQLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLHTLYLNDNTCLNNIPFELALCSNLQIMSLDNCPLSQIPSEIVVGGPSLIIRYLKMQGPYRTM
***************************SSTALLNSDSSRSDEYGYFEDMPEKDNKKCGVDVKKTVTVKHPESNKPKPTTKKKEPIQADLNIEKEFLRCKEENILNLDLSKSSITHLPPSVEKLTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRHNKLNELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIRELPPELGELKNLVTLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLESVPETLSKCVHLNEFNVEGCALSSLPDGLLSSLTSINNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLTELNLGTNQISKLSEDIQNLVNLEVLVLSNNLLKKLPSSIGNLRKLKCLDLEENKLESLPNEIGFLKELQRLILQSNQLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLHTLYLNDNTCLNNIPFELALCSNLQIMSLDNCPLSQIPSEIVVGGPSLIIRYLKMQGP****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTNKPKARSSSESRIAAERLASYREESSTALLNSDSSRSDEYGYFEDMPEKDNKKCGVDVKKTVTVKHPESNKPKPTTKKKEPIQADLNIEKEFLRCKEENILNLDLSKSSITHLPPSVEKLTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRHNKLNELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIRELPPELGELKNLVTLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLESVPETLSKCVHLNEFNVEGCALSSLPDGLLSSLTSINNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLTELNLGTNQISKLSEDIQNLVNLEVLVLSNNLLKKLPSSIGNLRKLKCLDLEENKLESLPNEIGFLKELQRLILQSNQLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLHTLYLNDNTCLNNIPFELALCSNLQIMSLDNCPLSQIPSEIVVGGPSLIIRYLKMQGPYRTM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query582 2.2.26 [Sep-21-2011]
B0W6M9628 Leucine-rich repeat prote N/A N/A 0.893 0.828 0.669 0.0
B4JTV9622 Leucine-rich repeat prote N/A N/A 0.893 0.836 0.633 0.0
B4LXW1614 Leucine-rich repeat prote N/A N/A 0.893 0.846 0.635 0.0
B5DX45629 Leucine-rich repeat prote yes N/A 0.893 0.826 0.638 0.0
Q9VEK6641 Leucine-rich repeat prote yes N/A 0.893 0.811 0.638 0.0
B3P3E8644 Leucine-rich repeat prote N/A N/A 0.893 0.807 0.636 0.0
A6QLV3582 Leucine-rich repeat prote yes N/A 0.979 0.979 0.586 0.0
Q8AVI4577 Leucine-rich repeat prote N/A N/A 0.979 0.987 0.580 0.0
B4PU77645 Leucine-rich repeat prote N/A N/A 0.893 0.806 0.636 0.0
Q5RAV5582 Leucine-rich repeat prote yes N/A 0.891 0.891 0.632 0.0
>sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 Back     alignment and function desciption
 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/520 (66%), Positives = 431/520 (82%)

Query: 63  KTVTVKHPESNKPKPTTKKKEPIQADLNIEKEFLRCKEENILNLDLSKSSITHLPPSVEK 122
           K VTVKHPESNKPKPTTKK + IQAD+++ KEF RCKEENIL LDLSKSSIT +PPSV+ 
Sbjct: 109 KVVTVKHPESNKPKPTTKKGKAIQADVDVIKEFQRCKEENILRLDLSKSSITVIPPSVKD 168

Query: 123 LTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRHNKL 182
            T L E YLYGNK++SLP +IG ++NL  L L ENSLTSLPDSL NL+ L+VLDLRHNKL
Sbjct: 169 CTSLIEFYLYGNKISSLPVEIGCLSNLKTLALNENSLTSLPDSLQNLKALKVLDLRHNKL 228

Query: 183 NELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIRELPPELGELKNLV 242
           +E+P V+YKL +L  LYLRFNRIK V  +++ LS+L+MLS+R+NKI ELP  +G L+NL 
Sbjct: 229 SEIPDVIYKLHTLTTLYLRFNRIKVVGDNLKNLSSLTMLSLRENKIHELPAAIGHLRNLT 288

Query: 243 TLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLESVPE 302
           TLDL+HNHL+ LP+ IGNC  L  LDLQHN+L++IP+ +GNL NL RL L YN+L ++P 
Sbjct: 289 TLDLSHNHLKHLPEAIGNCVNLTALDLQHNDLLDIPETIGNLANLQRLGLRYNQLTAIPV 348

Query: 303 TLSKCVHLNEFNVEGCALSSLPDGLLSSLTSINNITLSRNKFTAYPSGGPTQFTSVYSIN 362
           +L  C+H++EFNVEG ++S LPDGLL+SL+++  ITLSRN F +YPSGGP QFT+V SIN
Sbjct: 349 SLRNCIHMDEFNVEGNSISQLPDGLLASLSNLTTITLSRNAFHSYPSGGPAQFTNVTSIN 408

Query: 363 FEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLTELNLGTNQISKLSEDI 422
            EHNQIDKI YGIFSRAK L+K+NMK+N LTSLPLD+GTW  + ELN GTN ++KL +DI
Sbjct: 409 MEHNQIDKIQYGIFSRAKGLTKLNMKENALTSLPLDIGTWSQMVELNFGTNSLAKLPDDI 468

Query: 423 QNLVNLEVLVLSNNLLKKLPSSIGNLRKLKCLDLEENKLESLPNEIGFLKELQRLILQSN 482
             L NLE+L+LSNN+LK++P++IGNL+KL+ LDLEEN+LESLP+EIG L +LQ+LILQSN
Sbjct: 469 HCLQNLEILILSNNMLKRIPNTIGNLKKLRVLDLEENRLESLPSEIGLLHDLQKLILQSN 528

Query: 483 QLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLHTLYLNDNTCLNNIPFELALCS 542
            L SLPR IGHLTNL+YLSVGENNLQ +PEEIGTLENL +LY+NDN  L  +P+ELALC 
Sbjct: 529 ALQSLPRTIGHLTNLTYLSVGENNLQYLPEEIGTLENLESLYINDNASLVKLPYELALCQ 588

Query: 543 NLQIMSLDNCPLSQIPSEIVVGGPSLIIRYLKMQGPYRTM 582
           NL IMS++NCPLS +P E+V GGPSL+I+YLK+  PYR M
Sbjct: 589 NLAIMSIENCPLSALPPEVVGGGPSLVIQYLKLHSPYRQM 628
Acts as a Ras effector and participates in MAPK pathway activation. Probably acts as a regulatory subunit of protein phosphatase that specifically dephosphorylates Raf kinase and stimulate Raf activity at specialized signaling complexes upon Ras activation.
Culex quinquefasciatus (taxid: 7176)
>sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 Back     alignment and function description
>sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 Back     alignment and function description
>sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 Back     alignment and function description
>sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query582
156550592582 PREDICTED: leucine-rich repeat protein s 0.898 0.898 0.701 0.0
91091582565 PREDICTED: similar to shoc2 [Tribolium c 0.953 0.982 0.674 0.0
307178161624 Leucine-rich repeat protein SHOC-2 [Camp 0.900 0.839 0.704 0.0
383865861610 PREDICTED: leucine-rich repeat protein s 0.919 0.877 0.684 0.0
340712839610 PREDICTED: leucine-rich repeat protein s 0.919 0.877 0.686 0.0
380011078610 PREDICTED: leucine-rich repeat protein s 0.919 0.877 0.684 0.0
350422758610 PREDICTED: leucine-rich repeat protein s 0.919 0.877 0.682 0.0
357627630567 putative shoc2 [Danaus plexippus] 0.893 0.917 0.692 0.0
321472408630 hypothetical protein DAPPUDRAFT_315899 [ 0.903 0.834 0.705 0.0
328779859565 PREDICTED: leucine-rich repeat protein s 0.865 0.892 0.691 0.0
>gi|156550592|ref|XP_001603998.1| PREDICTED: leucine-rich repeat protein soc-2 homolog [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/523 (70%), Positives = 451/523 (86%)

Query: 60  DVKKTVTVKHPESNKPKPTTKKKEPIQADLNIEKEFLRCKEENILNLDLSKSSITHLPPS 119
           D KKTVTVKHPESNKPKPT KK +PIQADL++ KEF+RC++E    LDLSKSSIT+LP S
Sbjct: 60  DTKKTVTVKHPESNKPKPTAKKGKPIQADLDVAKEFIRCRDEGFKRLDLSKSSITNLPNS 119

Query: 120 VEKLTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRH 179
           V  LTHL E YLYGNKL +LP +IG + NL  L L+ENSLTSLPD+L NL+QL+VLDLRH
Sbjct: 120 VRDLTHLVEFYLYGNKLVTLPPEIGCLANLKTLALSENSLTSLPDTLENLKQLKVLDLRH 179

Query: 180 NKLNELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIRELPPELGELK 239
           NKLNE+P VVYKLTSL  L+LRFNR++ V  +I+ L+NL+MLS+R+NKI+ELP  +G+L 
Sbjct: 180 NKLNEIPDVVYKLTSLTTLFLRFNRVRYVSDNIRNLTNLTMLSLRENKIKELPAGIGKLT 239

Query: 240 NLVTLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLES 299
           NLVT D++HNHLE LP EIGNC  L TLDLQHNEL++IP+ +GNL+++TRL L YNRL S
Sbjct: 240 NLVTFDVSHNHLEHLPAEIGNCDQLSTLDLQHNELLDIPETIGNLVSVTRLGLRYNRLSS 299

Query: 300 VPETLSKCVHLNEFNVEGCALSSLPDGLLSSLTSINNITLSRNKFTAYPSGGPTQFTSVY 359
           +P++L+ C  ++EF+VEG  +S LPDGLLSSL+++  ITLSRN FTAYPSGGP+QFT+VY
Sbjct: 300 IPKSLANCKLMDEFSVEGNQVSQLPDGLLSSLSNLKTITLSRNAFTAYPSGGPSQFTNVY 359

Query: 360 SINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLTELNLGTNQISKLS 419
           SIN EHN+IDKIPYGIFSRAKNL+K+NMK+N LT+LPLD GTW+ + ELNLGTNQ+ K+ 
Sbjct: 360 SINLEHNKIDKIPYGIFSRAKNLTKLNMKENQLTALPLDTGTWINMVELNLGTNQLVKIP 419

Query: 420 EDIQNLVNLEVLVLSNNLLKKLPSSIGNLRKLKCLDLEENKLESLPNEIGFLKELQRLIL 479
           +DIQ L NLE+L+LSNNLLK++P+SI +L KL+ LDLEENK+ESLPNEIGFL++LQ+LIL
Sbjct: 420 DDIQYLQNLEILILSNNLLKRIPASIASLSKLRVLDLEENKIESLPNEIGFLRDLQKLIL 479

Query: 480 QSNQLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLHTLYLNDNTCLNNIPFELA 539
           QSNQ+ SLPRAIGHLTNL++LSVGENNL  +PEEIGTLENL  LY+NDN  L+N+PFELA
Sbjct: 480 QSNQVTSLPRAIGHLTNLTHLSVGENNLNYLPEEIGTLENLDCLYINDNANLHNLPFELA 539

Query: 540 LCSNLQIMSLDNCPLSQIPSEIVVGGPSLIIRYLKMQGPYRTM 582
           LC+NL IMS++NCPLSQIP EIV GGPSL+I++LKMQGPYR+M
Sbjct: 540 LCTNLSIMSIENCPLSQIPPEIVAGGPSLVIQFLKMQGPYRSM 582

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91091582|ref|XP_968188.1| PREDICTED: similar to shoc2 [Tribolium castaneum] gi|270001034|gb|EEZ97481.1| hypothetical protein TcasGA2_TC011315 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307178161|gb|EFN66969.1| Leucine-rich repeat protein SHOC-2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383865861|ref|XP_003708391.1| PREDICTED: leucine-rich repeat protein soc-2 homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|340712839|ref|XP_003394961.1| PREDICTED: leucine-rich repeat protein soc-2 homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|380011078|ref|XP_003689640.1| PREDICTED: leucine-rich repeat protein soc-2 homolog [Apis florea] Back     alignment and taxonomy information
>gi|350422758|ref|XP_003493273.1| PREDICTED: leucine-rich repeat protein soc-2 homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|357627630|gb|EHJ77268.1| putative shoc2 [Danaus plexippus] Back     alignment and taxonomy information
>gi|321472408|gb|EFX83378.1| hypothetical protein DAPPUDRAFT_315899 [Daphnia pulex] Back     alignment and taxonomy information
>gi|328779859|ref|XP_003249714.1| PREDICTED: leucine-rich repeat protein soc-2 homolog [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query582
FB|FBgn0038504641 Sur-8 "Sur-8" [Drosophila mela 0.893 0.811 0.584 4e-161
UNIPROTKB|A6QLV3582 SHOC2 "Leucine-rich repeat pro 0.852 0.852 0.602 8.4e-161
UNIPROTKB|Q9UQ13582 SHOC2 "Leucine-rich repeat pro 0.852 0.852 0.602 8.4e-161
UNIPROTKB|F2Z5G0582 SHOC2 "Uncharacterized protein 0.852 0.852 0.602 8.4e-161
UNIPROTKB|Q5RAV5582 SHOC2 "Leucine-rich repeat pro 0.852 0.852 0.602 8.4e-161
MGI|MGI:1927197582 Shoc2 "soc-2 (suppressor of cl 0.852 0.852 0.602 1.4e-160
UNIPROTKB|E2R260582 SHOC2 "Uncharacterized protein 0.852 0.852 0.602 1.7e-160
RGD|1308146582 Shoc2 "soc-2 (suppressor of cl 0.852 0.852 0.598 4.6e-160
UNIPROTKB|E1BU15582 SHOC2 "Leucine-rich repeat pro 0.852 0.852 0.594 1.6e-159
ZFIN|ZDB-GENE-050208-523561 shoc2 "soc-2 suppressor of cle 0.852 0.884 0.596 2e-159
FB|FBgn0038504 Sur-8 "Sur-8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1569 (557.4 bits), Expect = 4.0e-161, P = 4.0e-161
 Identities = 304/520 (58%), Positives = 378/520 (72%)

Query:    63 KTVTVKHPESNXXXXXXXXXEPIQADLNIEKEFLRCKEENILNLDLSKSSITHLPPSVEK 122
             K VTVKHPESN         +PIQAD ++ K   RC++E I  LDLSKSSIT +P +V++
Sbjct:   122 KMVTVKHPESNKPKPTTKKSKPIQADQDVIKALQRCRDEGIKRLDLSKSSITVIPSTVKE 181

Query:   123 LTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRHNKL 182
               HL ELYLY NK+  LP +IG + +L  L L ENSLTSLP+SL N  QL+VLDLRHNKL
Sbjct:   182 CVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKL 241

Query:   183 NELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIRELPPELGELKNLV 242
              E+P V+Y+L SL  LYLRFNRI  V  D++ L NL+MLS+R+NKIREL   +G L NL 
Sbjct:   242 AEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLT 301

Query:   243 TLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLESVPE 302
             TLD++HNHLE LP++IGNC  L  LDLQHNEL++IPD +GNL +L RL + YNRL SVP 
Sbjct:   302 TLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPA 361

Query:   303 TLSKCVHLNEFNVEGCAXXXXXXXXXXXXXXINNITLSRNKFTAYPSGGPTQFTSVYSIN 362
             TL  C  ++EFNVEG                +  ITLSRN+F +YP+GGP QFT+VYSIN
Sbjct:   362 TLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSIN 421

Query:   363 FEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLTELNLGTNQISKLSEDI 422
              EHN+IDKIPYGIFSRAK L+K+NMK+N+LT+LPLD+GTWV + ELNL TN + KL +DI
Sbjct:   422 LEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDI 481

Query:   423 QXXXXXXXXXXXXXXXXXXPSSIGNLRKLKCLDLEENKLESLPNEIGFLKELQRLILQSN 482
                                P++IGNLRKL+ LDLEEN++E LP+EIG L ELQRLILQ+N
Sbjct:   482 MNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTN 541

Query:   483 QLVSLPRAIGHLTNLSYLSVGENNLQSIPEEIGTLENLHTLYLNDNTCLNNIPFELALCS 542
             Q+  LPR+IGHL NL++LSV ENNLQ +PEEIG+LE+L  LY+N N  L  +PFELALC 
Sbjct:   542 QITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQ 601

Query:   543 NLQIMSLDNCPLSQIPSEIVVGGPSLIIRYLKMQGPYRTM 582
             NL+ +++D CPLS IP EI  GGPSL++++LKM  PYR M
Sbjct:   602 NLKYLNIDKCPLSTIPPEIQAGGPSLVLQWLKMHSPYRQM 641
GO:0017016 "Ras GTPase binding" evidence=ISS
GO:0000164 "protein phosphatase type 1 complex" evidence=IEA
GO:0046579 "positive regulation of Ras protein signal transduction" evidence=IEA
UNIPROTKB|A6QLV3 SHOC2 "Leucine-rich repeat protein SHOC-2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UQ13 SHOC2 "Leucine-rich repeat protein SHOC-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5G0 SHOC2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAV5 SHOC2 "Leucine-rich repeat protein SHOC-2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:1927197 Shoc2 "soc-2 (suppressor of clear) homolog (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R260 SHOC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1308146 Shoc2 "soc-2 (suppressor of clear) homolog (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BU15 SHOC2 "Leucine-rich repeat protein SHOC-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-523 shoc2 "soc-2 suppressor of clear homolog (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A7SFP1SHOC2_NEMVENo assigned EC number0.55810.94500.9532N/AN/A
A6QLV3SHOC2_BOVINNo assigned EC number0.58690.97930.9793yesN/A
B0W6M9SUR8_CULQUNo assigned EC number0.66920.89340.8280N/AN/A
B3P3E8SUR8_DROERNo assigned EC number0.63650.89340.8074N/AN/A
Q9VEK6SUR8_DROMENo assigned EC number0.63840.89340.8112yesN/A
B4N9T4SUR8_DROWINo assigned EC number0.64030.89340.8112N/AN/A
B3LWU3SUR8_DROANNo assigned EC number0.63650.89340.8112N/AN/A
Q1L8Y7SHOC2_DANRENo assigned EC number0.63240.87800.9108yesN/A
Q8AVI4SHOC2_XENLANo assigned EC number0.58000.97930.9878N/AN/A
B4JTV9SUR8_DROGRNo assigned EC number0.63330.89340.8360N/AN/A
O88520SHOC2_MOUSENo assigned EC number0.62590.90370.9037yesN/A
Q6AYI5SHOC2_RATNo assigned EC number0.58170.97930.9793yesN/A
B4LXW1SUR8_DROVINo assigned EC number0.63530.89340.8469N/AN/A
A8XWW4SHOC2_CAEBRNo assigned EC number0.57370.83840.8729N/AN/A
Q5RAV5SHOC2_PONABNo assigned EC number0.63230.89170.8917yesN/A
Q22875SHOC2_CAEELNo assigned EC number0.57780.83840.8729noN/A
Q5F4C4SHOC2_CHICKNo assigned EC number0.61080.78000.8582yesN/A
Q9UQ13SHOC2_HUMANNo assigned EC number0.63230.89170.8917yesN/A
B4PU77SUR8_DROYANo assigned EC number0.63650.89340.8062N/AN/A
B5DX45SUR8_DROPSNo assigned EC number0.63840.89340.8267yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query582
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-24
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-15
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-14
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-14
PLN032101153 PLN03210, PLN03210, Resistant to P 6e-14
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-14
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-13
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 4e-13
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-13
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-11
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 6e-10
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 9e-08
PRK15387788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 2e-07
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
PLN03210 1153 PLN03210, PLN03210, Resistant to P 6e-07
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 3e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  109 bits (275), Expect = 5e-25
 Identities = 140/496 (28%), Positives = 240/496 (48%), Gaps = 64/496 (12%)

Query: 103 ILNLDLSKSSIT-HLPPSVEKLTHLEELYLYGNKLA-SLPSQIGYVT-NLTCLGLAENSL 159
           ++++DLS  +I+  +  ++ +L +++ + L  N+L+  +P  I   + +L  L L+ N+ 
Sbjct: 71  VVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNF 130

Query: 160 TSLPDSLANLQQLRVLDLRHNKLN-ELPMVVYKLTSLKILYLRFN-RIKTVHPDIQYLSN 217
           T       ++  L  LDL +N L+ E+P  +   +SLK+L L  N  +  +   +  L++
Sbjct: 131 TG-SIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTS 189

Query: 218 LSMLSMRDNK-IRELPPELGELKNLVTLDLAHNHLE-ELPKEIGNCTMLVTLDLQHNELV 275
           L  L++  N+ + ++P ELG++K+L  + L +N+L  E+P EIG  T L  LDL +N L 
Sbjct: 190 LEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLT 249

Query: 276 N-IPDMLGNLINLTRLRLSYNRLE-SVPETLSKCVHLNEFNVEGCALSSLPDGLLSSLTS 333
             IP  LGNL NL  L L  N+L   +P ++     L   ++   +LS     L+  L +
Sbjct: 250 GPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQN 309

Query: 334 INNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLT 393
           +  + L  N FT                        KIP  + S  + L  + +  N  +
Sbjct: 310 LEILHLFSNNFTG-----------------------KIPVALTSLPR-LQVLQLWSNKFS 345

Query: 394 -SLPLDLGTWVGLTELNLGTNQIS-KLSEDIQNLVNLEVLVL-SNNLLKKLPSSIGNLRK 450
             +P +LG    LT L+L TN ++ ++ E + +  NL  L+L SN+L  ++P S+G  R 
Sbjct: 346 GEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRS 405

Query: 451 LKCLDLEENKLE-SLPNEIGFLKELQRLILQSN----------------QLVSLPRA--I 491
           L+ + L++N     LP+E   L  +  L + +N                Q++SL R    
Sbjct: 406 LRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFF 465

Query: 492 GHL------TNLSYLSVGENNLQ-SIPEEIGTLENLHTLYLNDNTCLNNIPFELALCSNL 544
           G L        L  L +  N    ++P ++G+L  L  L L++N     IP EL+ C  L
Sbjct: 466 GGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKL 525

Query: 545 QIMSLDNCPLS-QIPS 559
             + L +  LS QIP+
Sbjct: 526 VSLDLSHNQLSGQIPA 541

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 582
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472|consensus565 100.0
KOG0472|consensus565 100.0
KOG4194|consensus 873 100.0
KOG0444|consensus 1255 100.0
KOG0444|consensus 1255 100.0
KOG4194|consensus 873 100.0
KOG0618|consensus 1081 100.0
KOG0618|consensus 1081 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.9
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.9
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.88
KOG4237|consensus498 99.85
KOG4237|consensus498 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.84
KOG0617|consensus264 99.79
KOG0617|consensus264 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
KOG0532|consensus 722 99.46
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.45
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.42
KOG0532|consensus 722 99.42
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.3
KOG3207|consensus505 99.28
KOG3207|consensus505 99.27
PLN03150623 hypothetical protein; Provisional 99.26
KOG1909|consensus382 99.25
KOG1259|consensus490 99.24
KOG1909|consensus382 99.23
KOG1259|consensus490 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
KOG0531|consensus414 99.11
KOG4658|consensus889 99.11
KOG0531|consensus414 99.03
KOG4658|consensus889 98.99
KOG2120|consensus419 98.83
PLN03150623 hypothetical protein; Provisional 98.65
KOG1859|consensus 1096 98.52
KOG2120|consensus419 98.52
KOG4341|consensus483 98.49
KOG1859|consensus 1096 98.46
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.43
KOG4579|consensus177 98.4
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.39
KOG4579|consensus177 98.39
KOG2982|consensus 418 98.33
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.3
KOG2982|consensus418 98.28
KOG4341|consensus483 98.25
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.21
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.18
KOG3665|consensus699 98.15
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.13
KOG1644|consensus233 98.12
PRK15386 426 type III secretion protein GogB; Provisional 98.04
PRK15386 426 type III secretion protein GogB; Provisional 97.96
KOG3665|consensus 699 97.95
KOG1644|consensus233 97.83
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 97.71
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.53
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.49
KOG2739|consensus260 97.36
KOG2123|consensus 388 97.2
KOG2123|consensus388 96.99
KOG1947|consensus482 96.81
KOG2739|consensus260 96.79
KOG1947|consensus482 96.49
KOG4308|consensus 478 95.67
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.64
KOG4308|consensus 478 95.61
KOG0473|consensus326 95.15
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.14
KOG0473|consensus326 94.8
smart0037026 LRR Leucine-rich repeats, outliers. 94.59
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.59
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.56
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.86
smart0037026 LRR Leucine-rich repeats, outliers. 90.83
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.83
KOG3864|consensus221 86.92
KOG3864|consensus221 85.0
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.9e-54  Score=492.37  Aligned_cols=516  Identities=26%  Similarity=0.399  Sum_probs=305.8

Q ss_pred             HHHHHHHHHcccccCCCCCCCCCCCC------CCCCcccCCCCCeEEEEEcCCCCCCCCCCCCCCCccccccchHHHhhh
Q psy10956         25 REESSTALLNSDSSRSDEYGYFEDMP------EKDNKKCGVDVKKTVTVKHPESNKPKPTTKKKEPIQADLNIEKEFLRC   98 (582)
Q Consensus        25 ~~~~~~aLl~~k~~~~~~~~~l~~w~------~~~~~~c~~~~~~v~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   98 (582)
                      .++|++||++||+++.+|.+.+.+|.      .|.|+.|.. .++|+.+++.+..+.+.             ++..+..+
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~-------------~~~~~~~l   92 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNN-SSRVVSIDLSGKNISGK-------------ISSAIFRL   92 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCCCCCCCcCcceecCC-CCcEEEEEecCCCcccc-------------CChHHhCC
Confidence            34799999999999998988888993      466777764 35899999887655432             12222222


Q ss_pred             hccCccEEEccCCCCC-CCCccc-cCCCCCcEEEccCCCCc-ccChhccCCCCCCEEEccCCCCC-CcchhhhCCCCCCE
Q psy10956         99 KEENILNLDLSKSSIT-HLPPSV-EKLTHLEELYLYGNKLA-SLPSQIGYVTNLTCLGLAENSLT-SLPDSLANLQQLRV  174 (582)
Q Consensus        99 ~~~~l~~L~ls~~~~~-~l~~~~-~~l~~L~~L~l~~~~l~-~l~~~~~~l~~L~~L~l~~n~l~-~lp~~l~~l~~L~~  174 (582)
                        ++|+.|+|++|.++ .+|..+ ..+++|++|++++|.++ .+|.  +.+++|++|++++|.++ .+|..++++++|++
T Consensus        93 --~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~  168 (968)
T PLN00113         93 --PYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKV  168 (968)
T ss_pred             --CCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCE
Confidence              34666666666655 455443 25555555555555554 3332  23455555555555554 44555555555555


Q ss_pred             EeCCCCCCC-ccchhhhccccccEeecccCcCc-ccCccccCCCCCCEEEccCCcCc-ccCccccCCCCccEEeccCccC
Q psy10956        175 LDLRHNKLN-ELPMVVYKLTSLKILYLRFNRIK-TVHPDIQYLSNLSMLSMRDNKIR-ELPPELGELKNLVTLDLAHNHL  251 (582)
Q Consensus       175 L~L~~n~l~-~l~~~~~~~~~L~~L~l~~~~~~-~~~~~l~~l~~L~~L~l~~n~l~-~i~~~l~~l~~L~~L~l~~n~l  251 (582)
                      |++++|.+. .+|..+.++++|++|++++|.+. .+|..++.+++|++|++++|.+. .+|..++.+++|++|++++|.+
T Consensus       169 L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l  248 (968)
T PLN00113        169 LDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNL  248 (968)
T ss_pred             EECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCcee
Confidence            555555544 44444455555555555555544 33444455555555555555554 4444455555555555555544


Q ss_pred             c-ccCccccCCCCCcEEeCCCCCCC-CcchhhcCCCCCcEEEccCCcCCc-CCccccCCCCCCEEEecCCCCCCCChhhh
Q psy10956        252 E-ELPKEIGNCTMLVTLDLQHNELV-NIPDMLGNLINLTRLRLSYNRLES-VPETLSKCVHLNEFNVEGCALSSLPDGLL  328 (582)
Q Consensus       252 ~-~l~~~l~~~~~L~~L~l~~n~l~-~i~~~~~~~~~L~~L~l~~n~l~~-~~~~l~~~~~L~~L~l~~~~~~~~~~~~~  328 (582)
                      . .+|..++.+++|++|++++|.+. .+|..+..+++|+.|++++|.+.+ +|..+..+++|+.|++++|.+....+..+
T Consensus       249 ~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~  328 (968)
T PLN00113        249 TGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVAL  328 (968)
T ss_pred             ccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhH
Confidence            4 34444445555555555555444 344444444555555555554442 34444444445555544444443333334


Q ss_pred             ------------------------cCCCCCCEEEccCCcCccCCCCCCCCCCcccEEEcCCCCCCCCChhhhhcCCCCCE
Q psy10956        329 ------------------------SSLTSINNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSK  384 (582)
Q Consensus       329 ------------------------~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~~~i~~i~~~~~~~~~~L~~  384 (582)
                                              ..+++|+.|++++|.+++..+..+..+++++.+++++|.+.......+..+++|+.
T Consensus       329 ~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~  408 (968)
T PLN00113        329 TSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRR  408 (968)
T ss_pred             hcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCE
Confidence                                    44444555555555444443344444445555555555554333334455666666


Q ss_pred             EeccCCcCCc-ccccccCCCCCCEEECcCCCCC-ccchhhhCCCCCCEEECcCCCCC-ccccccCCCCCCCEEeCCCCCC
Q psy10956        385 VNMKDNLLTS-LPLDLGTWVGLTELNLGTNQIS-KLSEDIQNLVNLEVLVLSNNLLK-KLPSSIGNLRKLKCLDLEENKL  461 (582)
Q Consensus       385 L~l~~n~l~~-l~~~~~~~~~L~~L~l~~n~l~-~~~~~l~~~~~L~~L~ls~n~l~-~i~~~l~~~~~L~~L~L~~n~l  461 (582)
                      |++++|.+++ +|..+..++.|+.+++++|.++ .++..+..+++|+.|++++|.+. .+|..+ ..++|+.|++++|++
T Consensus       409 L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l  487 (968)
T PLN00113        409 VRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQF  487 (968)
T ss_pred             EECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCcc
Confidence            6666666653 4555666666666666666666 34444556667777777777665 444433 456777777777777


Q ss_pred             C-CCcccccCCCcCCEEEccCCCCc-cccccccCCCCCCEEECCCCCCC-cCcccccCCCCCCEEeCCCCCCCCCCCccc
Q psy10956        462 E-SLPNEIGFLKELQRLILQSNQLV-SLPRAIGHLTNLSYLSVGENNLQ-SIPEEIGTLENLHTLYLNDNTCLNNIPFEL  538 (582)
Q Consensus       462 ~-~l~~~l~~~~~L~~L~l~~n~l~-~i~~~l~~~~~L~~L~ls~n~l~-~i~~~~~~l~~L~~L~l~~n~~~~~~~~~l  538 (582)
                      + .+|..+..+++|++|++++|.+. .+|..+.++++|++|++++|.++ .+|..+..+++|++|++++|++.+.+|..+
T Consensus       488 ~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l  567 (968)
T PLN00113        488 SGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNL  567 (968)
T ss_pred             CCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhH
Confidence            6 45666777788888888888776 66777777888888888888887 467777788888888888888888888778


Q ss_pred             ccCCCCCEEecCCCCCC-CCcH
Q psy10956        539 ALCSNLQIMSLDNCPLS-QIPS  559 (582)
Q Consensus       539 ~~l~~L~~L~ls~n~l~-~i~~  559 (582)
                      ..+++|+.|++++|+++ .+|.
T Consensus       568 ~~l~~L~~l~ls~N~l~~~~p~  589 (968)
T PLN00113        568 GNVESLVQVNISHNHLHGSLPS  589 (968)
T ss_pred             hcCcccCEEeccCCcceeeCCC
Confidence            88888888888888877 5664

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query582
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-13
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 8e-11
2o6q_A 270 Structural Diversity Of The Hagfish Variable Lympho 3e-05
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-12
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-12
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-12
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 8e-06
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 2e-11
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 1e-06
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 3e-11
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 3e-11
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 6e-05
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 3e-11
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 6e-05
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 4e-11
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 7e-05
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 4e-11
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 4e-05
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 5e-11
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 4e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 5e-11
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 5e-11
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 4e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 6e-11
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 6e-11
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 4e-05
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 6e-11
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 7e-05
4eco_A636 Crystal Structure Of A Hypothetical Protein (Bacegg 6e-11
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 7e-11
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 8e-05
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 7e-11
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 7e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 8e-11
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 1e-10
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-10
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-10
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 3e-10
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 3e-06
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 5e-10
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 4e-04
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 2e-09
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 1e-08
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 3e-04
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 2e-08
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 3e-07
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 4e-08
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 5e-08
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 4e-08
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 1e-04
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 1e-07
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 2e-07
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 8e-04
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-07
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-05
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 4e-07
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-05
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 4e-07
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 6e-07
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 1e-06
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 2e-06
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-06
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 2e-06
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 4e-06
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 5e-06
4ecn_A876 Crystal Structure Of A Leucine-Rich Repeat Protein 7e-05
3g06_A622 The Salmonella Virulence Effector Ssph2 Functions A 7e-05
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 9e-05
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 9e-05
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 6e-04
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 9e-05
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 6e-04
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 1e-04
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 1e-04
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 2e-04
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 2e-04
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 2e-04
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 2e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 4e-04
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 5e-04
2xot_A361 Crystal Structure Of Neuronal Leucine Rich Repeat P 7e-04
2wqx_A289 Inlb321_4r: S199r, D200r, G206r, A227r, C242a Mutan 7e-04
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure 
Iteration: 1

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 107/240 (44%), Gaps = 52/240 (21%)
Query: 155 AENSLTSLPDSLANLQQLRVLDLRHNKLNELP-MVVYKLTSLKILYLRFNRIKTVHPDI- 212
           +   LT++P ++      + LDL+ NKL+ LP    ++LT L++LYL  N+++T+   I 
Sbjct: 24  SSKKLTAIPSNIP--ADTKKLDLQSNKLSSLPSKAFHRLTKLRLLYLNDNKLQTLPAGIF 81
Query: 213 QYLSNLSMLSMRDNKIRELP-PELGELKNLVTLDLAHNHLEELPKEIGNCTMLVTLDLQH 271
           + L NL  L + DNK++ LP     +L NL  L L  N L+ LP                
Sbjct: 82  KELKNLETLWVTDNKLQALPIGVFDQLVNLAELRLDRNQLKSLP---------------- 125
Query: 272 NELVNIPDMLGNLINLTRLRLSYNRLESVPE-TLSKCVHLNEFNVEGCAXXXXXXXXXXX 330
                 P +  +L  LT L L YN L+S+P+    K   L E                  
Sbjct: 126 ------PRVFDSLTKLTYLSLGYNELQSLPKGVFDKLTSLKE------------------ 161
Query: 331 XXXINNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDN 390
                 + L  N+    P G   + T + ++  ++NQ+ ++P G F   + L  + +++N
Sbjct: 162 ------LRLYNNQLKRVPEGAFDKLTELKTLKLDNNQLKRVPEGAFDSLEKLKMLQLQEN 215
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|4ECN|A Chain A, Crystal Structure Of A Leucine-Rich Repeat Protein (Bt_0210) From Bacteroides Thetaiotaomicron Vpi-5482 At 2.80 A Resolution Length = 876 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|2WQX|A Chain A, Inlb321_4r: S199r, D200r, G206r, A227r, C242a Mutant Of The Listeria Monocytogenes Inlb Internalin Domain Length = 289 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query582
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-82
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-73
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-59
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-28
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-82
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-75
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-71
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-60
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-59
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-42
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-76
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-57
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-72
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-70
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-64
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-57
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-54
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-45
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-42
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-72
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-64
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-61
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-59
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-68
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-38
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-67
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-54
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-50
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-39
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-64
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-63
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-62
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-51
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-43
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-35
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-63
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-61
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-60
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-48
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-46
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-32
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-62
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-48
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-32
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 9e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-62
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-61
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-47
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-40
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-61
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-58
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-54
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-46
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-43
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-60
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-59
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-55
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-49
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-43
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-59
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-57
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-56
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-50
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-58
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-55
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-51
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-36
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-57
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-55
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-55
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-51
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-54
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-48
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-40
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-34
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-53
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-46
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-46
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-46
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-43
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-39
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-35
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-52
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-50
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-47
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-45
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-37
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-52
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-51
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-50
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-50
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-46
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-45
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-40
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-40
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-37
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-24
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-49
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-45
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-21
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-18
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-49
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-47
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-23
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-48
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-47
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-38
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-20
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-43
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-41
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-38
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-34
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-11
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-40
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-38
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-28
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-26
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-40
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-39
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-37
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-36
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-39
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-37
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-35
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-34
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-28
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-39
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-39
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-39
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-39
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-33
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 8e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-38
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-37
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-33
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-32
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-30
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-38
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-37
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-33
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-31
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-30
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-36
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-36
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-36
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-32
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-32
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-32
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-29
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-36
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-33
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-30
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-28
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-28
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-35
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-30
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-29
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-28
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-26
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-25
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-33
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-31
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-30
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-29
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-22
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 6e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-33
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-31
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-28
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-27
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-22
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-32
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-29
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-27
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-23
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-22
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-30
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-29
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-27
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-26
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-29
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-29
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-25
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-23
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-23
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-16
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-27
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-27
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-26
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-25
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-18
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-16
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-14
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-26
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-22
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-20
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-24
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-23
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-22
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-19
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-23
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-23
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-22
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-22
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-23
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-22
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-20
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-22
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-20
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-20
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-20
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-22
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-18
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-14
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-22
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-19
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-15
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-14
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-14
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-20
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-18
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-18
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-16
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-15
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-20
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-20
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-18
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-19
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-17
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-17
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-16
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-17
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-16
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-16
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-16
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-15
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-14
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-12
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-16
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-15
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-14
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-13
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-14
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-14
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-10
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-12
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-12
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-10
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-10
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-10
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-10
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-10
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 4e-04
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
 Score =  274 bits (702), Expect = 3e-82
 Identities = 85/476 (17%), Positives = 181/476 (38%), Gaps = 59/476 (12%)

Query: 104 LNLDLSKSSITHLPPSVEKLTHLEELYLYGNKLASLPSQIGYVTNLTCLGLAENSLTSLP 163
             +    + IT +  ++++LT L+ +Y   +        +                 +  
Sbjct: 428 TQIGNLTNRITFISKAIQRLTKLQIIYFANSPFTYDNIAVD---WEDANSDYAKQYENEE 484

Query: 164 DSLANLQQLRVLDLRH-NKLNELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLS 222
            S +NL+ L  ++L +   + +LP  +Y L  L+ L +  NR  +        + L    
Sbjct: 485 LSWSNLKDLTDVELYNCPNMTQLPDFLYDLPELQSLNIACNRGISAAQLKADWTRL---- 540

Query: 223 MRDNKIRELPPELGELKNLVTLDLAHNHLEELPKE--IGNCTMLVTLDLQHNELVNIPDM 280
                      +      +    + +N+LEE P    +     L  LD  HN++ ++   
Sbjct: 541 ---------ADDEDTGPKIQIFYMGYNNLEEFPASASLQKMVKLGLLDCVHNKVRHLEA- 590

Query: 281 LGNLINLTRLRLSYNRLESVPETLSKCV-HLNEFNVEGCALSSLPDGL-LSSLTSINNIT 338
            G  + LT L+L YN++E +PE        +         L  +P+     S+  + ++ 
Sbjct: 591 FGTNVKLTDLKLDYNQIEEIPEDFCAFTDQVEGLGFSHNKLKYIPNIFNAKSVYVMGSVD 650

Query: 339 LSRNKFTAYPSGGPT-----QFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLT 393
            S NK  +            +  +  ++   +N+I K P  +F+    +S + + +NL+T
Sbjct: 651 FSYNKIGSEGRNISCSMDDYKGINASTVTLSYNEIQKFPTELFATGSPISTIILSNNLMT 710

Query: 394 SLPLD--------LGTWVGLTELNLGTNQISKLSEDIQ--NLVNLEVLVLSNNLLKKLPS 443
           S+P +              LT ++L  N+++ LS+D +   L  L  + +S N     P+
Sbjct: 711 SIPENSLKPKDGNYKNTYLLTTIDLRFNKLTSLSDDFRATTLPYLSNMDVSYNCFSSFPT 770

Query: 444 SIGNLRKLKCLDLEENKLESLPNEIGFLKELQRLILQSNQLV-SLPRAIGHLTNLSYLSV 502
              N  +LK   +                       + N+++   P  I    +L  L +
Sbjct: 771 QPLNSSQLKAFGIRHQ-----------------RDAEGNRILRQWPTGITTCPSLIQLQI 813

Query: 503 GENNLQSIPEEIGTLENLHTLYLNDN--TCLNNIPFELALCSNLQIMSLDNCPLSQ 556
           G N+++ + E++     L+ L + DN    ++       + + + ++  D     +
Sbjct: 814 GSNDIRKVDEKL--TPQLYILDIADNPNISIDVTSVCPYIEAGMYVLLYDKTQDIR 867
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query582
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.71
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.7
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.7
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.58
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.57
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.55
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.53
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.49
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.46
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.41
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.41
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.31
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.29
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.28
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.23
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.21
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.19
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.97
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.77
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.69
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.68
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.62
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.31
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.03
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.89
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.81
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.77
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.67
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.36
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.22
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=8.7e-59  Score=515.37  Aligned_cols=531  Identities=25%  Similarity=0.337  Sum_probs=301.0

Q ss_pred             hHHHHHHHHHHcccccCCCCCCCCCCC------CCCCCcccCCCCCeEEEEEcCCCCCCCC---C--CCCCCC-------
Q psy10956         23 SYREESSTALLNSDSSRSDEYGYFEDM------PEKDNKKCGVDVKKTVTVKHPESNKPKP---T--TKKKEP-------   84 (582)
Q Consensus        23 ~~~~~~~~aLl~~k~~~~~~~~~l~~w------~~~~~~~c~~~~~~v~~l~~~~~~~~~~---~--~~~~~~-------   84 (582)
                      .+.++|++||++||+++.||. .+++|      |.|.||.|+  .+||+++++.+..+.+.   .  ......       
T Consensus         8 ~~~~~~~~all~~k~~~~~~~-~l~~W~~~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~   84 (768)
T 3rgz_A            8 QSLYREIHQLISFKDVLPDKN-LLPDWSSNKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFL   84 (768)
T ss_dssp             CCHHHHHHHHHHHHTTCSCTT-SSTTCCTTSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEEC
T ss_pred             cCCHHHHHHHHHHHhhCCCcc-cccCCCCCCCCcCCcceEEC--CCcEEEEECCCCCcCCccCccChhHhccCcccccCC
Confidence            335679999999999999998 88999      367778887  57999999988765432   0  000000       


Q ss_pred             -ccccccchHHHhhhhccCccEEEccCCCCC-CCCc--cccCCCCCcEEEccCCCCc-ccChh-----------------
Q psy10956         85 -IQADLNIEKEFLRCKEENILNLDLSKSSIT-HLPP--SVEKLTHLEELYLYGNKLA-SLPSQ-----------------  142 (582)
Q Consensus        85 -~~~~~~~~~~~~~~~~~~l~~L~ls~~~~~-~l~~--~~~~l~~L~~L~l~~~~l~-~l~~~-----------------  142 (582)
                       ......++..+..  ..+|++|+|++|.++ .+|.  .++++++|++|++++|.+. .+|..                 
T Consensus        85 ~~~~~~~l~~~~~~--l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~  162 (768)
T 3rgz_A           85 SNSHINGSVSGFKC--SASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANS  162 (768)
T ss_dssp             TTSCEEECCCCCCC--CTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSC
T ss_pred             cCCCcCCCchhhcc--CCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCc
Confidence             0000000001111  123444444444444 2333  3444444444444444333 22221                 


Q ss_pred             -----------c----------------------cCCCCCCEEEccCCCCCCcchhhhCCCCCCEEeCCCCCCC-ccchh
Q psy10956        143 -----------I----------------------GYVTNLTCLGLAENSLTSLPDSLANLQQLRVLDLRHNKLN-ELPMV  188 (582)
Q Consensus       143 -----------~----------------------~~l~~L~~L~l~~n~l~~lp~~l~~l~~L~~L~L~~n~l~-~l~~~  188 (582)
                                 +                      ..+++|++|++++|.++..+..++++++|++|++++|.++ .+|..
T Consensus       163 l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~  242 (768)
T 3rgz_A          163 ISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRA  242 (768)
T ss_dssp             CEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSCHHHH
T ss_pred             cCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCCcccHH
Confidence                       2                      2333444444444444421112555555555555555554 44444


Q ss_pred             hhccccccEeecccCcCcccCccccCCCCCCEEEccCCcCc-ccCccccCC-CCccEEeccCccCc-ccCccccCCCCCc
Q psy10956        189 VYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDNKIR-ELPPELGEL-KNLVTLDLAHNHLE-ELPKEIGNCTMLV  265 (582)
Q Consensus       189 ~~~~~~L~~L~l~~~~~~~~~~~l~~l~~L~~L~l~~n~l~-~i~~~l~~l-~~L~~L~l~~n~l~-~l~~~l~~~~~L~  265 (582)
                      +..+++|++|++++|.+....+.. .+++|++|++++|.++ .+|..+... ++|++|++++|.++ .+|..++.+++|+
T Consensus       243 l~~l~~L~~L~Ls~n~l~~~~~~~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~  321 (768)
T 3rgz_A          243 ISTCTELKLLNISSNQFVGPIPPL-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLE  321 (768)
T ss_dssp             TTTCSSCCEEECCSSCCEESCCCC-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCC
T ss_pred             HhcCCCCCEEECCCCcccCccCcc-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCcc
Confidence            555555555555555554222222 4455555555555554 455554443 66666666666665 4555566666666


Q ss_pred             EEeCCCCCCC-Ccchh-hcCCCCCcEEEccCCcCC-cCCccccCC---------------------------CCCCEEEe
Q psy10956        266 TLDLQHNELV-NIPDM-LGNLINLTRLRLSYNRLE-SVPETLSKC---------------------------VHLNEFNV  315 (582)
Q Consensus       266 ~L~l~~n~l~-~i~~~-~~~~~~L~~L~l~~n~l~-~~~~~l~~~---------------------------~~L~~L~l  315 (582)
                      +|++++|.+. .+|.. +..+++|++|++++|.++ .+|..+..+                           ++|++|++
T Consensus       322 ~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L  401 (768)
T 3rgz_A          322 SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL  401 (768)
T ss_dssp             EEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEEC
T ss_pred             EEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEEC
Confidence            6666666665 45543 556666666666666555 244444333                           33444444


Q ss_pred             cCCCCCCCChhhhcCCCCCCEEEccCCcCccCCCCCCCCCCcccEEEcCCCCCCCCChhhhhcCCCCCEEeccCCcCCc-
Q psy10956        316 EGCALSSLPDGLLSSLTSINNITLSRNKFTAYPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTS-  394 (582)
Q Consensus       316 ~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~~~i~~i~~~~~~~~~~L~~L~l~~n~l~~-  394 (582)
                      ++|.+....+..+..+++|++|++++|.+++..+..+..+++|+.|++++|.+.......+..+++|+.|++++|.+++ 
T Consensus       402 ~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~  481 (768)
T 3rgz_A          402 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGE  481 (768)
T ss_dssp             CSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSC
T ss_pred             CCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCc
Confidence            4444442223335555566666666666655555555556666666666666653333445556666666666666663 


Q ss_pred             ccccccCCCCCCEEECcCCCCC-ccchhhhCCCCCCEEECcCCCCC-ccccccCCCCCCCEEeCCCCCCC-CCccc----
Q psy10956        395 LPLDLGTWVGLTELNLGTNQIS-KLSEDIQNLVNLEVLVLSNNLLK-KLPSSIGNLRKLKCLDLEENKLE-SLPNE----  467 (582)
Q Consensus       395 l~~~~~~~~~L~~L~l~~n~l~-~~~~~l~~~~~L~~L~ls~n~l~-~i~~~l~~~~~L~~L~L~~n~l~-~l~~~----  467 (582)
                      +|..+..+++|++|++++|.++ .+|..+..+++|++|++++|.++ .+|..+..+++|+.|++++|.++ .+|..    
T Consensus       482 ~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~  561 (768)
T 3rgz_A          482 IPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQ  561 (768)
T ss_dssp             CCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTT
T ss_pred             CCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcc
Confidence            4556666666666666666666 45666666666666666666666 56666666666777776666554 33322    


Q ss_pred             ------------------------------------------------------------------ccCCCcCCEEEccC
Q psy10956        468 ------------------------------------------------------------------IGFLKELQRLILQS  481 (582)
Q Consensus       468 ------------------------------------------------------------------l~~~~~L~~L~l~~  481 (582)
                                                                                        ++.+++|++|++++
T Consensus       562 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~  641 (768)
T 3rgz_A          562 SGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSY  641 (768)
T ss_dssp             TTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCS
T ss_pred             cchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcC
Confidence                                                                              22245566677777


Q ss_pred             CCCc-cccccccCCCCCCEEECCCCCCC-cCcccccCCCCCCEEeCCCCCCCCCCCcccccCCCCCEEecCCCCCC-CCc
Q psy10956        482 NQLV-SLPRAIGHLTNLSYLSVGENNLQ-SIPEEIGTLENLHTLYLNDNTCLNNIPFELALCSNLQIMSLDNCPLS-QIP  558 (582)
Q Consensus       482 n~l~-~i~~~l~~~~~L~~L~ls~n~l~-~i~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~ls~n~l~-~i~  558 (582)
                      |+++ .+|..++.++.|+.|++++|+++ .+|..++++++|++|+|++|.+.+.+|..+..+++|++|++++|+++ .||
T Consensus       642 N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP  721 (768)
T 3rgz_A          642 NMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIP  721 (768)
T ss_dssp             SCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECC
T ss_pred             CcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCC
Confidence            7765 66666777777777777777776 56667777777777777777777777777777777777777777766 555


Q ss_pred             H
Q psy10956        559 S  559 (582)
Q Consensus       559 ~  559 (582)
                      .
T Consensus       722 ~  722 (768)
T 3rgz_A          722 E  722 (768)
T ss_dssp             S
T ss_pred             C
Confidence            4
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 582
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-16
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-10
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-08
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-18
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-16
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-15
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-14
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-11
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-10
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-09
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-06
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 3e-06
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.004
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 8e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 96.2 bits (238), Expect = 4e-22
 Identities = 87/383 (22%), Positives = 154/383 (40%), Gaps = 39/383 (10%)

Query: 167 ANLQQLRVLDLRHNKLNELPMVVYKLTSLKILYLRFNRIKTVHPDIQYLSNLSMLSMRDN 226
             L +     L    + +       L  +  L      IK++   ++YL+NL+ ++  +N
Sbjct: 19  TALAEKMKTVLGKTNVTDTV-SQTDLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNN 76

Query: 227 KIRELPPELGELKNLVTLDLAHNHLEELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLIN 286
           ++ ++ P L  L  LV  D+  N+ +            +T     N  +   D L NL N
Sbjct: 77  QLTDITP-LKNLTKLV--DILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTN 133

Query: 287 LTRLRLSYNRLESVPETLSKCVHLNEFNVEGCALSSLPDGLLSSLTSINNITLSRNKFTA 346
           L RL LS N +  +                           L++LT++  + +S NK + 
Sbjct: 134 LNRLELSSNTISDISALSGLTSLQQLSFGNQV----TDLKPLANLTTLERLDISSNKVSD 189

Query: 347 YPSGGPTQFTSVYSINFEHNQIDKIPYGIFSRAKNLSKVNMKDNLLTSLPLDLGTWVGLT 406
                  + T++ S+   +NQI  I         NL ++++  N L  +   L +   LT
Sbjct: 190 ISV--LAKLTNLESLIATNNQISDITPLGIL--TNLDELSLNGNQLKDIG-TLASLTNLT 244

Query: 407 ELNLGTNQISKLSEDIQNLVNLEVLVLSNNLLKKLPSSIG-------------------- 446
           +L+L  NQIS L+  +  L  L  L L  N +  +    G                    
Sbjct: 245 DLDLANNQISNLAP-LSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPI 303

Query: 447 -NLRKLKCLDLEENKLESLPNEIGFLKELQRLILQSNQLVSLPRAIGHLTNLSYLSVGEN 505
            NL+ L  L L  N +  +   +  L +LQRL   +N++  +  ++ +LTN+++LS G N
Sbjct: 304 SNLKNLTYLTLYFNNISDIS-PVSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHN 361

Query: 506 NLQSIPEEIGTLENLHTLYLNDN 528
            +  +   +  L  +  L LND 
Sbjct: 362 QISDLT-PLANLTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query582
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.98
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.89
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.6
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.58
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.43
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.38
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.15
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.12
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.22
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.1
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.04
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.79
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.63
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.98  E-value=3.9e-32  Score=266.69  Aligned_cols=286  Identities=25%  Similarity=0.352  Sum_probs=232.3

Q ss_pred             hHHHHHHHHHHcccccCCCCCCCCCCCCCCCCccc--CCCCCeEEEEEcCCCCCCCCCCCCCCCccccccchHHHhhhhc
Q psy10956         23 SYREESSTALLNSDSSRSDEYGYFEDMPEKDNKKC--GVDVKKTVTVKHPESNKPKPTTKKKEPIQADLNIEKEFLRCKE  100 (582)
Q Consensus        23 ~~~~~~~~aLl~~k~~~~~~~~~l~~w~~~~~~~c--~~~~~~v~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  100 (582)
                      -|.++||+||++||+++.||. .+++|.. ++..|  .|.|     |.|+..+..                         
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~~-~~d~C~~~w~g-----v~C~~~~~~-------------------------   49 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWLP-TTDCCNRTWLG-----VLCDTDTQT-------------------------   49 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCT-TSCTTTTCSTT-----EEECCSSSC-------------------------
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCCC-CCCCCCCcCCC-----eEEeCCCCc-------------------------
Confidence            489999999999999999885 6889953 33555  3888     888653211                         


Q ss_pred             cCccEEEccCCCCC---CCCccccCCCCCcEEEccC-CCCc-ccChhccCCCCCCEEEccCCCCCC-cchhhhCCCCCCE
Q psy10956        101 ENILNLDLSKSSIT---HLPPSVEKLTHLEELYLYG-NKLA-SLPSQIGYVTNLTCLGLAENSLTS-LPDSLANLQQLRV  174 (582)
Q Consensus       101 ~~l~~L~ls~~~~~---~l~~~~~~l~~L~~L~l~~-~~l~-~l~~~~~~l~~L~~L~l~~n~l~~-lp~~l~~l~~L~~  174 (582)
                      .+|+.|+|+++.++   .+|+.++++++|++|+|++ |.+. .+|..++++++|++|++++|++.. .+..+..+++|++
T Consensus        50 ~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~  129 (313)
T d1ogqa_          50 YRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVT  129 (313)
T ss_dssp             CCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCE
T ss_pred             EEEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcc
Confidence            35899999999887   4889999999999999986 7787 899999999999999999999984 4566888999999


Q ss_pred             EeCCCCCCC-ccchhhhccccccEeecccCcCc-ccCccccCCCCC-CEEEccCCcCc-ccCccccCCCCccEEeccCcc
Q psy10956        175 LDLRHNKLN-ELPMVVYKLTSLKILYLRFNRIK-TVHPDIQYLSNL-SMLSMRDNKIR-ELPPELGELKNLVTLDLAHNH  250 (582)
Q Consensus       175 L~L~~n~l~-~l~~~~~~~~~L~~L~l~~~~~~-~~~~~l~~l~~L-~~L~l~~n~l~-~i~~~l~~l~~L~~L~l~~n~  250 (582)
                      ++++.|.+. .+|..+.+++.|+++++++|.+. .+|..+..+..+ +.+++++|+++ ..+..+..+.. ..+++.++.
T Consensus       130 l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~-~~l~l~~~~  208 (313)
T d1ogqa_         130 LDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNL-AFVDLSRNM  208 (313)
T ss_dssp             EECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCC-SEEECCSSE
T ss_pred             cccccccccccCchhhccCcccceeecccccccccccccccccccccccccccccccccccccccccccc-ccccccccc
Confidence            999999877 77888889999999999999888 667777777775 88899999888 45555665544 468888877


Q ss_pred             Cc-ccCccccCCCCCcEEeCCCCCCCCcchhhcCCCCCcEEEccCCcCC-cCCccccCCCCCCEEEecCCCCC-CCChhh
Q psy10956        251 LE-ELPKEIGNCTMLVTLDLQHNELVNIPDMLGNLINLTRLRLSYNRLE-SVPETLSKCVHLNEFNVEGCALS-SLPDGL  327 (582)
Q Consensus       251 l~-~l~~~l~~~~~L~~L~l~~n~l~~i~~~~~~~~~L~~L~l~~n~l~-~~~~~l~~~~~L~~L~l~~~~~~-~~~~~~  327 (582)
                      .. .+|..++.+++++.++++++.+...+..+..+++|+.|++++|+++ .+|..++.+++|++|++++|.++ .+|.  
T Consensus       209 ~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~--  286 (313)
T d1ogqa_         209 LEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ--  286 (313)
T ss_dssp             EEECCGGGCCTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC--
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC--
Confidence            66 5666778888899999999888866667888889999999999888 48888888888888888888887 5654  


Q ss_pred             hcCCCCCCEEEccCCc
Q psy10956        328 LSSLTSINNITLSRNK  343 (582)
Q Consensus       328 ~~~~~~L~~L~l~~n~  343 (582)
                      +..+++|+.+++.+|+
T Consensus       287 ~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         287 GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             STTGGGSCGGGTCSSS
T ss_pred             cccCCCCCHHHhCCCc
Confidence            4667788888888776
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure