Diaphorina citri psyllid: psy10969

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----

MSEISFTDRAYCKMILHAVKYPHCSINGVLLAVTVPTTKESPKKLTYVDAIPLFHLCLQVTPMIEIALTQISSYAQSNGLVIAGYYLANENIKDVSYDKPYQSRIADKIAEFFPAACLIVLDNRKLTQTMQESALIVAQNSDGKWKPVSKNSIIVDQTTLSSVSTLIQRNISRHLVDFDNHLDNLSADWTNSELNEIIEKEYQT

cccEEEcHHHHHHHHHHHcccccccccEEEEcccccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEEEcccccccccccEEEEEEcccccEEEcccccccccccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHcc

***ISFTDRAYCKMILHAVKYPHCSINGVLLAVTVPTTKESPKKLTYVDAIPLFHLCLQVTPMIEIALTQISSYAQSNGLVIAGYYLANENIKDVSYDKPYQSRIADKIAEFFPAACLIVLDNRKLTQTMQESALIVAQNSDGKWKPVSKNSIIVDQTTLSSVSTLIQRNISRHLVDFDNHLDNLSADWTNSELNEIIEKE***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ER membrane protein complex subunit 9		confident	Q5U1W7
ER membrane protein complex subunit 9		confident	Q9Y3B6
ER membrane protein complex subunit 8/9 homolog		confident	Q9W1Y1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043234 [CC]	protein complex	confident	GO:0005575, GO:0032991
GO:0043231 [CC]	intracellular membrane-bounded organelle	confident	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044446 [CC]	intracellular organelle part	confident	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]	cytoplasmic part	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0072546 [CC]	ER membrane protein complex	probable	GO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0030176, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0055120 [CC]	striated muscle dense body	probable	GO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2O95, chain A
Confidence level:confident
Coverage over the Query: 16-141
View the alignment between query and template
View the model in PyMOL