Diaphorina citri psyllid: psy10995

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MTDDGCITCECQDEDGVWRDDSEIWRDGCRECHCIDGREMCTLIACPTLSCQHPIPANSTQCCPYCPDATSSGHEAAVCMDFHGELKLEGQHWTLNPCTDCTCREGKVLCYSQQCPAAACSNPRPPEPGTCCPRCAGADEITALVVEDPLRKESTPSLSPSDLEIPRIGDEYLSCLLENGTLLHVGDTYFADPCTNCTCLHGGQKKCTASMCERKALEKGDTPTPPSGNDSPESATNRQIRESLYILLIVLFAVSTLFAFYACRQ
ccccccccccCEccccEECccccCCccccccEEEccccEEEECccccccccccccccccccccccccccccccccccEEcccccEEEccccCCcccccEEEEEcccEEEECccccccccccccccccccccccccccccccccCECccccccccccccccccccccccccccccEECcccEEECcccCCcccccEEEEEccccEEECccccccccccccccccccccccccccccccccEEEEEEEHHHHHHHHHHHHEEEEccc
MTDDGCITCECQDEDGVWRDDSEIWRDGCRECHCIDGREMCTLIACPTLSCQHPIPANSTQCCPYCPDATSSGHEAAVCMDFHGELKLEGQHWTLNPCTDCTCREGKVLCYSQQCPAAACSNPRPPEPGTCCPRCAGADEITALVVEDPLRKESTPSLSPSDLEIPRIGDEYLSCLLENGTLLHVGDTYFADPCTNCTCLHGGQKKCTASMCERKALE***********DSPESATNRQIRESLYILLIVLFAVSTLFAFYACR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDDGCITCECQDEDGVWRDDSEIWRDGCRECHCIDGREMCTLIACPTLSCQHPIPANSTQCCPYCPDATSSGHEAAVCMDFHGELKLEGQHWTLNPCTDCTCREGKVLCYSQQCPAAACSNPRPPEPGTCCPRCAGADEITALVVEDPLRKESTPSLSPSDLEIPRIGDEYLSCLLENGTLLHVGDTYFADPCTNCTCLHGGQKKCTASMCERKALEKGDTPTPPSGNDSPESATNRQIRESLYILLIVLFAVSTLFAFYACRQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0090092 [BP]regulation of transmembrane receptor protein serine/threonine kinase signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0032502 [BP]developmental processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U5M, chain A
Confidence level:very confident
Coverage over the Query: 76-138
View the alignment between query and template
View the model in PyMOL
Template: 1U5M, chain A
Confidence level:very confident
Coverage over the Query: 11-69
View the alignment between query and template
View the model in PyMOL
Template: 3ARC, chain L
Confidence level:probable
Coverage over the Query: 238-262
View the alignment between query and template
View the model in PyMOL