Diaphorina citri psyllid: psy10999

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------

INKHYYYYFYKSITGLISKPFSTDFQEAASNNNKNAYDRFRESNMESVKYSTLRGQLDFVTHDKPVDISEVEPAAEIVKRFATGAMSFGSISIEAHTTLAKAMNKIGAKSNTGEGGENPERYLSSGDENQRSAIKQGKLYPKTYCFLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTKDIASTRHSVPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLALNNLRSRVVLQADGQIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRKKFAGKPEHVINYLFMLAEEVSRDYRAESPGFDFPLVWLGDFKQEGDQLSLVWGTLTMKVTSRKLPLLKI

cccccEEEEEccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHccccccccccccccccccHHHHHHccccccccccccccccccccHHcHHHHHHHHHccccccccEEEEEEcccccHHHcccccccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccEEcccccccccccccccccccccccccccccccc

*NKHYYYYFYKSITGLISKPFSTDFQEAASNNNKNAYDRFRESNMESVKYSTLRGQLDFVTHDKPVDISEVEPAAEIVKRFATGAMSFGSISIEAHTTLAKAMNKIGAK*****G*E**E*Y****************LYPKTYCFLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTKDIASTRHSVPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLALNNLRSRVVLQADGQIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRKKFAGKPEHVINYLFMLAEEVSRDYRAESPGFDFPLVWLGDFKQEGDQLSLVWGTLTMKVTSRKLPLLKI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Glutamate synthase [NADH]	Forms L-glutamate from L-glutamine and 2-oxoglutarate. Represents an alternative pathway to L-glutamate dehydrogenase for the biosynthesis of L-glutamate. Participates with glutamine synthetase in ammonia assimilation processes. The enzyme is specific for NADH, L-glutamine and 2-oxoglutarate.	confident	Q12680
Glutamate synthase 1 [NADH], chloroplastic	Involved in glutamate biosynthesis. Required for non-photorespiratory ammonium assimilation. Probably involved in primary ammonium assimilation in roots.	confident	Q9LV03
Glutamate synthase [NADPH] large chain		confident	Q05755

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0009570 [CC]	chloroplast stroma	probable	GO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0019676 [BP]	ammonia assimilation cycle	probable	GO:0043648, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:0044238, GO:0044237, GO:0006520, GO:0006541, GO:0019752, GO:0071704, GO:0006536, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0009064, GO:0043436, GO:1901605
GO:0048589 [BP]	developmental growth	probable	GO:0044767, GO:0032502, GO:0008150, GO:0040007, GO:0044699
GO:0010181 [MF]	FMN binding	probable	GO:0043168, GO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:1901265, GO:0003674, GO:0043167, GO:1901363, GO:0032553, GO:0005488
GO:0042128 [BP]	nitrate assimilation	probable	GO:0042126, GO:0044710, GO:0071941, GO:0006082, GO:0009987, GO:0044237, GO:2001057, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0055114 [BP]	oxidation-reduction process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016040 [MF]	glutamate synthase (NADH) activity	probable	GO:0015930, GO:0016638, GO:0016639, GO:0003824, GO:0003674, GO:0045181, GO:0016491
GO:0051536 [MF]	iron-sulfur cluster binding	probable	GO:0003674, GO:0051540, GO:0005488
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005506 [MF]	iron ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0006537 [BP]	glutamate biosynthetic process	probable	GO:0044238, GO:0044283, GO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:0009064, GO:1901576, GO:0044710, GO:0044711, GO:0043650, GO:0006520, GO:0071704, GO:1901605, GO:1901607, GO:0008652, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0043648, GO:1901564, GO:1901566, GO:0006082, GO:0046394, GO:0016053, GO:0044237, GO:0006536, GO:0009084
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0060359 [BP]	response to ammonium ion	probable	GO:0042221, GO:1901698, GO:0008150, GO:0050896
GO:0050660 [MF]	flavin adenine dinucleotide binding	probable	GO:0043168, GO:0050662, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VKJ, chain A
Confidence level:very confident
Coverage over the Query: 62-186,205-353,382-423
View the alignment between query and template
View the model in PyMOL

Template: 1VCF, chain A
Confidence level:very confident
Coverage over the Query: 63-190,207-355,383-421
View the alignment between query and template
View the model in PyMOL

Template: 2NLI, chain A
Confidence level:confident
Coverage over the Query: 16-188,208-356,384-422
View the alignment between query and template
View the model in PyMOL

Template: 1ME8, chain A
Confidence level:confident
Coverage over the Query: 231-431
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
1ea0, chain A		very confident	Alignment \| Template Structure