Psyllid ID: psy10999

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------

INKHYYYYFYKSITGLISKPFSTDFQEAASNNNKNAYDRFRESNMESVKYSTLRGQLDFVTHDKPVDISEVEPAAEIVKRFATGAMSFGSISIEAHTTLAKAMNKIGAKSNTGEGGENPERYLSSGDENQRSAIKQGKLYPKTYCFLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTKDIASTRHSVPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLALNNLRSRVVLQADGQIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRKKFAGKPEHVINYLFMLAEEVSRDYRAESPGFDFPLVWLGDFKQEGDQLSLVWGTLTMKVTSRKLPLLKI

cccccEEEEEccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHccccccccccccccccccHHHHHHccccccccccccccccccccHHcHHHHHHHHHccccccccEEEEEEcccccHHHcccccccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccEEcccccccccccccccccccccccccccccccc

cccccEEEEcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHccccccccccHHHcccHHHHHHHHHcccccccHHcHHHHHHHHHHHHHccccccccccccccHHccEccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHcHHHHHHHHHcccccccccccccccccHHHHHHcccccccccccccccccEEEHHHHHHHHHHHHHcccccEEEEEEEEEccHEHHHHHHHHccccEEEEEccccccccccccHHHHccccHHHcHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHcHHHHcHcHHHHHHHHHHHHHHHcccccccEEEcccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccEHHHHHHHHHcHHHHccEcHHHHcccHHHcccccccc

INKHYYYYFYKSITgliskpfstdfQEAASNNNKNAYDRFRESNMESVKYSTLRGQldfvthdkpvdisevePAAEIVKRFATGAMSFGSISIEAHTTLAKAMNKigaksntgeggenperylssgdenqrsaikqgklypktYCFLSslftdlfpvyglpvasgrfgvtssylaHADDLQIKmaqgakpgeggelpgykvtkdiastrhsvpgvglisppphhdiysIEDLAELIYDlkcanpnariSVKLVSEVGVGVVASGVAKGKAEHIVisghdggtgasswtgiknaglpwelgVAETHQVLALNNLRSRVVLqadgqirtGFDVVVAALLGAdeiglstaplitmgctmmrkchlntcpvgiatqdpelrkkfagkpeHVINYLFMLAEEVsrdyraespgfdfplvwlgdfkqegdqLSLVWGTLTmkvtsrklpllki

INKHYYYYFYKSITGLISKPFSTDFQEAASNNNKNAYDRFRESNMESVKYSTLRGQLDFVTHDKPVDISEVEPAAEIVKRFATGAMSFGSISIEAHTTLAKAMNKIgaksntgeggenPERYLSSGDENQRSAIKQGKLYPKTYCFLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTKDIASTRHSVPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARISVKLVSEVGVGVVASGVAKGKAEHIVISghdggtgasSWTGIKNAGLPWELGVAETHQVLALNNLRSRVVLQADGQIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRKKFAGKPEHVINYLFMLAEEVSRDYRAESPGFDFPLVWLGDFKQEGDQLSLVWgtltmkvtsrklpllki

INKHYYYYFYKSITGLISKPFSTDFQEAASNNNKNAYDRFRESNMESVKYSTLRGQLDFVTHDKPVDISEVEPAAEIVKRFATGAMSFGSISIEAHTTLAKAMNKIGAKSNTGEGGENPERYLSSGDENQRSAIKQGKLYPKTYCFLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTKDIASTRHSVPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARIsvklvsevgvgvvasgvakgkaEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLALNNLRSRVVLQADGQIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRKKFAGKPEHVINYLFMLAEEVSRDYRAESPGFDFPLVWLGDFKQEGDQLSLVWGTLTMKVTSRKLPLLKI

***HYYYYFYKSITGLISKPFS***************************YSTLRGQLDFVTHDKPVDISEVEPAAEIVKRFATGAMSFGSISIEAHTTLA************************************GKLYPKTYCFLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQIK***************YKVTKDIA*TRHSVPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLALNNLRSRVVLQADGQIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRKKFAGKPEHVINYLFMLAEEVSRDYRAESPGFDFPLVWLGDFKQEGDQLSLVWGTLTMKVT*********

*NKHYYYYFYKSITGLISKPFSTDFQEAASNNNKNAYDRFRESNMESVKYSTLRGQLDFVTHDKPVDISEVEPAAEIVKRFATGAMSFGSISIEAHTTLAKAMNKIGAK*****G*E**E*Y****************LYPKTYCFLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTKDIASTRHSVPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLALNNLRSRVVLQADGQIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRKKFAGKPEHVINYLFMLAEEVSRDYRAESPGFDFPLVWLGDFKQEGDQLSLVWGTLTMKVTSRKLPLLKI

*NKHYYYYFYKSITGLISKPFSTDFQEAASNNNKNAYDRFRESNMESVKYSTLRGQLDFVTHDKPVDISEVEPAAEIVKRFATGAMSFGSISIEAHTTLAKAMNKIGAK*******ENPERYLSSGD*N*********LYPKTYCFLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTKDIASTRHSVPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLALNNLRSRVVLQADGQIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRKKFAGKPEHVINYLFMLAEEVSRDYRAESPGFDFPLVWLGDFKQEGDQLSLVWGTLTMKVTSRKLPLLKI

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		447	2.2.26 [Sep-21-2011]
Q9LV03		2208	Glutamate synthase 1 [NAD	yes	N/A	0.821	0.166	0.648	1e-141
Q9C102		2111	Putative glutamate syntha	yes	N/A	0.778	0.164	0.652	1e-140
Q03460		2194	Glutamate synthase [NADH]	N/A	N/A	0.821	0.167	0.648	1e-140
Q0DG35		2188	Glutamate synthase 2 [NAD	yes	N/A	0.821	0.167	0.648	1e-139
Q0JKD0		2167	Glutamate synthase 1 [NAD	yes	N/A	0.821	0.169	0.646	1e-133
Q12680		2145	Glutamate synthase [NADH]	yes	N/A	0.823	0.171	0.582	1e-131
P55037		1550	Ferredoxin-dependent glut	N/A	N/A	0.778	0.224	0.602	1e-124
P39812		1520	Glutamate synthase [NADPH	yes	N/A	0.787	0.231	0.589	1e-122
P96218		1527	Glutamate synthase [NADPH	yes	N/A	0.747	0.218	0.602	1e-119
Q05755		1515	Glutamate synthase [NADPH	yes	N/A	0.778	0.229	0.538	1e-109

>sp\|Q9LV03\|GLUT1_ARATH Glutamate synthase 1 [NADH], chloroplastic OS=Arabidopsis thaliana GN=GLT1 PE=1 SV=2	Back alignment and function desciption

 Score =  501 bits (1291), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 257/396 (64%), Positives = 298/396 (75%), Gaps = 29/396 (7%)

Query: 7    YYFYKSITGLISKPFS-TDFQEAASNNNKNAYDRFRESNMESVKYSTLRGQLDFVTHDKP 65
            Y++ K+    ++ P +    QEAA  N+  AY  + +   E  K S LRG + F   D  
Sbjct: 938  YHWRKNGEIHLNDPLAIAKLQEAARTNSVAAYKEYSKRINELNKQSNLRGLMKFKDADVK 997

Query: 66   VDISEVEPAAEIVKRFATGAMSFGSISIEAHTTLAKAMNKIGAKSNTGEGGENPERY--L 123
            + + EVEPA+EIVKRF TGAMS+GSIS+EAHTTLA AMNK+G KSNTGEGGE P R   L
Sbjct: 998  IPLDEVEPASEIVKRFCTGAMSYGSISLEAHTTLAMAMNKLGGKSNTGEGGELPSRMEPL 1057

Query: 124  SSGDEN-QRSAIKQGKLYPKTYCFLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQI 182
            + G  N +RS+IKQ                         +ASGRFGV+S YL +AD+LQI
Sbjct: 1058 ADGSRNPKRSSIKQ-------------------------IASGRFGVSSYYLTNADELQI 1092

Query: 183  KMAQGAKPGEGGELPGYKVTKDIASTRHSVPGVGLISPPPHHDIYSIEDLAELIYDLKCA 242
            KMAQGAKPGEGGELPG+KV  DIA TR+S  GVGLISPPPHHDIYSIEDLA+LI+DLK A
Sbjct: 1093 KMAQGAKPGEGGELPGHKVIGDIAITRNSTAGVGLISPPPHHDIYSIEDLAQLIHDLKNA 1152

Query: 243  NPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVA 302
            NP ARISVKLVSE GVGV+ASGV KG A+H++I+GHDGGTGAS WTGIKNAGLPWELG+A
Sbjct: 1153 NPGARISVKLVSEAGVGVIASGVVKGHADHVLIAGHDGGTGASRWTGIKNAGLPWELGLA 1212

Query: 303  ETHQVLALNNLRSRVVLQADGQIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHL 362
            ETHQ L  N+LR R VLQ DGQ++TG DV VAALLGA+E G STAPLIT+GC MMRKCH 
Sbjct: 1213 ETHQTLVANDLRGRTVLQTDGQLKTGRDVAVAALLGAEEFGFSTAPLITLGCIMMRKCHK 1272

Query: 363  NTCPVGIATQDPELRKKFAGKPEHVINYLFMLAEEV 398
            NTCPVGIATQDP LR+KFAG+PEHVIN+ FMLAEEV
Sbjct: 1273 NTCPVGIATQDPVLREKFAGEPEHVINFFFMLAEEV 1308

Involved in glutamate biosynthesis. Required for non-photorespiratory ammonium assimilation. Probably involved in primary ammonium assimilation in roots.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 4

>sp\|Q9C102\|GLT1_SCHPO Putative glutamate synthase [NADPH] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glt1 PE=2 SV=1	Back alignment and function description

>sp\|Q03460\|GLSN_MEDSA Glutamate synthase [NADH], amyloplastic OS=Medicago sativa PE=1 SV=1	Back alignment and function description

>sp\|Q0DG35\|GLT2_ORYSJ Glutamate synthase 2 [NADH], chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0555600 PE=2 SV=2	Back alignment and function description

>sp\|Q0JKD0\|GLT1_ORYSJ Glutamate synthase 1 [NADH], chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0681900 PE=2 SV=1	Back alignment and function description

>sp\|Q12680\|GLT1_YEAST Glutamate synthase [NADH] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLT1 PE=1 SV=2	Back alignment and function description

>sp\|P55037\|GLTB_SYNY3 Ferredoxin-dependent glutamate synthase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gltB PE=1 SV=1	Back alignment and function description

>sp\|P39812\|GLTA_BACSU Glutamate synthase [NADPH] large chain OS=Bacillus subtilis (strain 168) GN=gltA PE=2 SV=3	Back alignment and function description

>sp\|P96218\|GLTB_MYCTU Glutamate synthase [NADPH] large chain OS=Mycobacterium tuberculosis GN=gltB PE=1 SV=3	Back alignment and function description

>sp\|Q05755\|GLTB_AZOBR Glutamate synthase [NADPH] large chain OS=Azospirillum brasilense GN=gltB PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		447
328721168		2080	PREDICTED: putative glutamate synthase [	0.834	0.179	0.750	1e-166
357624914		2044	glutamate synthase [Danaus plexippus]	0.798	0.174	0.794	1e-164
260834439		2071	hypothetical protein BRAFLDRAFT_129259 [	0.836	0.180	0.723	1e-164
115292419		2046	glutamate synthase [Bombyx mori] gi\|1137	0.812	0.177	0.785	1e-163
91084143		2029	PREDICTED: similar to glutamate synthase	0.778	0.171	0.784	1e-162
443695222		2047	hypothetical protein CAPTEDRAFT_177943 [	0.796	0.173	0.757	1e-162
405969003		2212	Glutamate synthase [NADH], amyloplastic	0.796	0.160	0.733	1e-161
391347925		2077	PREDICTED: glutamate synthase 1 [NADH],	0.825	0.177	0.717	1e-161
195127541		2117	GI11930 [Drosophila mojavensis] gi\|19391	0.825	0.174	0.752	1e-160
194872333		2114	GG15849 [Drosophila erecta] gi\|190654793	0.825	0.174	0.752	1e-160

>gi\|328721168\|ref\|XP_001948786.2\| PREDICTED: putative glutamate synthase [NADPH]-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score =  590 bits (1522), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 313/417 (75%), Positives = 339/417 (81%), Gaps = 44/417 (10%)

Query: 3    KHYYYYFYKSITGL-----------------ISKPFS-TDFQEAASNNNKNAYDRFRESN 44
            +HY  Y Y++   L                 I+ P S  + Q+AA+N + N+YD+F ES 
Sbjct: 822  RHYLSYSYRNTDMLVLMNPGYFHWRTGGEKHINDPISIANLQDAATNKSTNSYDKFCEST 881

Query: 45   MESVKYSTLRGQLDFVTHDKPVDISEVEPAAEIVKRFATGAMSFGSISIEAHTTLAKAMN 104
            MESV+  TLRGQL+ V   K ++ISEVEPAA IVKRFATGAMS GSISIEAHT+LA AMN
Sbjct: 882  MESVRACTLRGQLELVPTTKSINISEVEPAANIVKRFATGAMSLGSISIEAHTSLAIAMN 941

Query: 105  KIGAKSNTGEGGENPERYLSSGDEN-QRSAIKQGKLYPKTYCFLSSLFTDLFPVYGLPVA 163
            K+G KSNTGEGGEN +RYL+   EN +RSAIKQ                         VA
Sbjct: 942  KLGGKSNTGEGGENSDRYLNQDSENNKRSAIKQ-------------------------VA 976

Query: 164  SGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTKDIASTRHSVPGVGLISPPPH 223
            SGRFGVTSSYLAHADD+QIKMAQGAKPGEGGELPGYKVTKDIA+TRHSVPGVGLISPPPH
Sbjct: 977  SGRFGVTSSYLAHADDIQIKMAQGAKPGEGGELPGYKVTKDIAATRHSVPGVGLISPPPH 1036

Query: 224  HDIYSIEDLAELIYDLKCANPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTG 283
            HDIYSIEDLAELIYDLKCANPN RISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTG
Sbjct: 1037 HDIYSIEDLAELIYDLKCANPNGRISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTG 1096

Query: 284  ASSWTGIKNAGLPWELGVAETHQVLALNNLRSRVVLQADGQIRTGFDVVVAALLGADEIG 343
            ASSWTGIKNAGLPWELGVAETHQVL LNNLRSRVV+QADGQIRTGFDV+VAALLGADEIG
Sbjct: 1097 ASSWTGIKNAGLPWELGVAETHQVLVLNNLRSRVVVQADGQIRTGFDVIVAALLGADEIG 1156

Query: 344  LSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRKKFAGKPEHVINYLFMLAEEVSR 400
            LSTAPLI +GCTMMRKCHLNTCPVGIATQDP LRKKFAGKPEHVINYLFMLAE+V +
Sbjct: 1157 LSTAPLIVLGCTMMRKCHLNTCPVGIATQDPVLRKKFAGKPEHVINYLFMLAEDVRK 1213

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi\|357624914\|gb\|EHJ75509.1\| glutamate synthase [Danaus plexippus]	Back alignment and taxonomy information

>gi\|260834439\|ref\|XP_002612218.1\| hypothetical protein BRAFLDRAFT_129259 [Branchiostoma floridae] gi\|229297593\|gb\|EEN68227.1\| hypothetical protein BRAFLDRAFT_129259 [Branchiostoma floridae]	Back alignment and taxonomy information

>gi\|115292419\|ref\|NP_001041678.1\| glutamate synthase [Bombyx mori] gi\|113734246\|dbj\|BAF30425.1\| glutamate synthase [Bombyx mori]	Back alignment and taxonomy information

>gi\|91084143\|ref\|XP_970053.1\| PREDICTED: similar to glutamate synthase [Tribolium castaneum] gi\|270006644\|gb\|EFA03092.1\| hypothetical protein TcasGA2_TC013000 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|443695222\|gb\|ELT96170.1\| hypothetical protein CAPTEDRAFT_177943 [Capitella teleta]	Back alignment and taxonomy information

>gi\|405969003\|gb\|EKC34018.1\| Glutamate synthase [NADH], amyloplastic [Crassostrea gigas]	Back alignment and taxonomy information

>gi\|391347925\|ref\|XP_003748204.1\| PREDICTED: glutamate synthase 1 [NADH], chloroplastic-like [Metaseiulus occidentalis]	Back alignment and taxonomy information

>gi\|195127541\|ref\|XP_002008227.1\| GI11930 [Drosophila mojavensis] gi\|193919836\|gb\|EDW18703.1\| GI11930 [Drosophila mojavensis]	Back alignment and taxonomy information

>gi\|194872333\|ref\|XP_001973010.1\| GG15849 [Drosophila erecta] gi\|190654793\|gb\|EDV52036.1\| GG15849 [Drosophila erecta]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		447
FB\|FBgn0036663		2114	CG9674 [Drosophila melanogaste	0.534	0.113	0.828	3.4e-139
WB\|WBGene00012326		2175	W07E11.1 [Caenorhabditis elega	0.530	0.108	0.772	1.1e-125
ASPGD\|ASPL0000027159		2126	gltA [Emericella nidulans (tax	0.530	0.111	0.708	5.3e-117
TAIR\|locus:2178461		2208	GLT1 "NADH-dependent glutamate	0.530	0.107	0.717	1.1e-116
UNIPROTKB\|Q0JKD0		2167	LOC_Os01g48960 "Glutamate synt	0.530	0.109	0.713	3.3e-116
POMBASE\|SPAPB1E7.07		2111	glt1 "glutamate synthase Glt1	0.530	0.112	0.696	2.3e-114
CGD\|CAL0000516		2126	GLT1 [Candida albicans (taxid:	0.550	0.115	0.661	1.7e-110
SGD\|S000002330		2145	GLT1 "NAD(+)-dependent glutama	0.530	0.110	0.649	1.1e-106
UNIPROTKB\|P55037		1550	gltB "Ferredoxin-dependent glu	0.550	0.158	0.633	2.1e-104
UNIPROTKB\|P96218		1527	gltB "Glutamate synthase [NADP	0.550	0.161	0.608	2.8e-100

FB\|FBgn0036663 CG9674 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 1044 (372.6 bits), Expect = 3.4e-139, Sum P(2) = 3.4e-139
 Identities = 198/239 (82%), Positives = 208/239 (87%)

Query:   162 VASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTKDIASTRHSVPGVGLISPP 221
             VASGRFGVT+SYLA+ADDLQIKMAQGAKPGEGGELPGYKVTKDIA TR SVPGVGLISPP
Sbjct:  1010 VASGRFGVTASYLANADDLQIKMAQGAKPGEGGELPGYKVTKDIAKTRKSVPGVGLISPP 1069

Query:   222 PHHDIYSIEDLAELIYDLKCANPNARIXXXXXXXXXXXXXXXXXXXXXXEHIVISGHDGG 281
             PHHDIYSIEDLAELIYDLKC+NPNARI                      EHIVISGHDGG
Sbjct:  1070 PHHDIYSIEDLAELIYDLKCSNPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGG 1129

Query:   282 TGASSWTGIKNAGLPWELGVAETHQVLALNNLRSRVVLQADGQIRTGFDVVVAALLGADE 341
             TGASSWTGIKNAGLPWELGVAETHQVL LNNLRSRV++QADGQ+RTGFDVVVAALLGADE
Sbjct:  1130 TGASSWTGIKNAGLPWELGVAETHQVLVLNNLRSRVIVQADGQLRTGFDVVVAALLGADE 1189

Query:   342 IGLSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRKKFAGKPEHVINYLFMLAEEVSR 400
              G STAPLI MGCTMMRKCHLNTCPVGIATQDPELRKKF GKPEHVIN+ FMLAE++ +
Sbjct:  1190 FGFSTAPLIVMGCTMMRKCHLNTCPVGIATQDPELRKKFTGKPEHVINFFFMLAEDIRK 1248

GO:0004355 "glutamate synthase (NADPH) activity" evidence=ISS

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0005506 "iron ion binding" evidence=IEA

GO:0016040 "glutamate synthase (NADH) activity" evidence=IEA

GO:0010181 "FMN binding" evidence=IEA

GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA

GO:0006537 "glutamate biosynthetic process" evidence=IEA

GO:0051536 "iron-sulfur cluster binding" evidence=IEA

WB\|WBGene00012326 W07E11.1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000027159 gltA [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

TAIR\|locus:2178461 GLT1 "NADH-dependent glutamate synthase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q0JKD0 LOC_Os01g48960 "Glutamate synthase 1 [NADH], chloroplastic" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

POMBASE\|SPAPB1E7.07 glt1 "glutamate synthase Glt1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

CGD\|CAL0000516 GLT1 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

SGD\|S000002330 GLT1 "NAD(+)-dependent glutamate synthase (GOGAT)" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

UNIPROTKB\|P55037 gltB "Ferredoxin-dependent glutamate synthase 1" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)]	Back alignment and assigned GO terms

UNIPROTKB\|P96218 gltB "Glutamate synthase [NADPH] large chain" [Mycobacterium tuberculosis (taxid:1773)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q05755	GLTB_AZOBR	1, ., 4, ., 1, ., 1, 3	0.5386	0.7785	0.2297	yes	N/A
Q0DG35	GLT2_ORYSJ	1, ., 4, ., 1, ., 1, 4	0.6489	0.8210	0.1677	yes	N/A
P39812	GLTA_BACSU	1, ., 4, ., 1, ., 1, 3	0.5890	0.7874	0.2315	yes	N/A
Q9C102	GLT1_SCHPO	1, ., 4, ., 1, ., 1, 3	0.6525	0.7785	0.1648	yes	N/A
P96218	GLTB_MYCTU	1, ., 4, ., 1, ., 1, 3	0.6022	0.7472	0.2187	yes	N/A
O29309	AGLUS_ARCFU	1, ., 4, ., 1, ., 1, 3	0.3730	0.7561	0.6614	yes	N/A
Q9LV03	GLUT1_ARATH	1, ., 4, ., 1, ., 1, 4	0.6489	0.8210	0.1662	yes	N/A
Q3Z7F6	AGLUS_DEHE1	1, ., 4, ., 1, ., 1, 3	0.3700	0.7136	0.638	yes	N/A
Q12680	GLT1_YEAST	1, ., 4, ., 1, ., 1, 4	0.5829	0.8232	0.1715	yes	N/A
Q0JKD0	GLT1_ORYSJ	1, ., 4, ., 1, ., 1, 4	0.6464	0.8210	0.1693	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		447
pfam01645		367	pfam01645, Glu_synthase, Conserved region in gluta	0.0
COG0069		485	COG0069, GltB, Glutamate synthase domain 2 [Amino	0.0
cd02808		392	cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-b	1e-167
PRK11750		1485	PRK11750, gltB, glutamate synthase subunit alpha;	1e-162
cd04722		200	cd04722, TIM_phosphate_binding, TIM barrel protein	2e-07

>gnl\|CDD\|110632 pfam01645, Glu_synthase, Conserved region in glutamate synthase	Back alignment and domain information

 Score =  541 bits (1396), Expect = 0.0
 Identities = 220/375 (58%), Positives = 254/375 (67%), Gaps = 31/375 (8%)

Query: 26  QEAASNNNKNAYDRFRESNMESVKYSTLRGQLDFVTHDKPVDISEVEPAAEIVKRFATGA 85
           Q+A    +  +YD++RE   E V    LR  L+F   + P+ I EVEPA EI  RF TGA
Sbjct: 12  QKAVQVESYPSYDKYREPLNERVPIGALRDLLEFDYAEDPIPIEEVEPALEIKTRFCTGA 71

Query: 86  MSFGSISIEAHTTLAKAMNKIGAKSNTGEGGENPERYLSSGDENQRSAIKQGKLYPKTYC 145
           MS+G++S EAH  LAKAMN++G KSNTGEGGE+PER   + D     AIKQ         
Sbjct: 72  MSYGALSEEAHEALAKAMNRLGTKSNTGEGGEDPERLKYAAD----GAIKQ--------- 118

Query: 146 FLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTKDI 205
                           VASGRFGVT  YL +AD ++IK+AQGAKPGEGG LPG KV+ +I
Sbjct: 119 ----------------VASGRFGVTPEYLNNADAIEIKIAQGAKPGEGGHLPGEKVSPEI 162

Query: 206 ASTRHSVPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARISVKLVSEVGVGVVASGV 265
           A  R S PGVGLISPPPHHDIYSIEDLA+LIYDLK  NP A ISVKLVS  GVG +A+GV
Sbjct: 163 ARIRGSPPGVGLISPPPHHDIYSIEDLAQLIYDLKEINPKAPISVKLVSGHGVGTIAAGV 222

Query: 266 AKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLALNNLRSRVVLQADGQI 325
           AK  A+ I+I GHDGGTGAS  T IK+AGLPWEL +AE HQ L  N LR RV L ADG +
Sbjct: 223 AKAGADIILIDGHDGGTGASPKTSIKHAGLPWELALAEVHQTLVENGLRDRVSLIADGGL 282

Query: 326 RTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRK--KFAGK 383
           RTG DV  AA LGAD + + TA LI +GC M R CH NTCPVG+ATQDPELRK   F G 
Sbjct: 283 RTGADVAKAAALGADAVYIGTAALIALGCIMCRVCHTNTCPVGVATQDPELRKRLDFEGA 342

Query: 384 PEHVINYLFMLAEEV 398
           PE V+NY   LAEEV
Sbjct: 343 PERVVNYFRFLAEEV 357

This family represents a region of the glutamate synthase protein. This region is expressed as a separate subunit in the glutamate synthase alpha subunit from archaebacteria, or part of a large multidomain enzyme in other organisms. The aligned region of these proteins contains a putative FMN binding site and Fe-S cluster. Length = 367

>gnl\|CDD\|223147 COG0069, GltB, Glutamate synthase domain 2 [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|239202 cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|236968 PRK11750, gltB, glutamate synthase subunit alpha; Provisional	Back alignment and domain information

>gnl\|CDD\|240073 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		447
COG0069		485	GltB Glutamate synthase domain 2 [Amino acid trans	100.0
KOG0399\|consensus		2142		100.0
PRK11750		1485	gltB glutamate synthase subunit alpha; Provisional	100.0
PF01645		368	Glu_synthase: Conserved region in glutamate syntha	100.0
cd02808		392	GltS_FMN Glutamate synthase (GltS) FMN-binding dom	100.0
KOG0538\|consensus		363		100.0
PRK11197		381	lldD L-lactate dehydrogenase; Provisional	100.0
PLN02493		367	probable peroxisomal (S)-2-hydroxy-acid oxidase	100.0
PF01070		356	FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR	100.0
cd04736		361	MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin	100.0
PLN02979		366	glycolate oxidase	100.0
cd03332		383	LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin	100.0
TIGR02708		367	L_lactate_ox L-lactate oxidase. Members of this pr	100.0
PLN02535		364	glycolate oxidase	100.0
cd02922		344	FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom	100.0
cd04737		351	LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d	100.0
COG1304		360	idi Isopentenyl diphosphate isomerase (BS_ypgA, MT	100.0
PRK05437		352	isopentenyl pyrophosphate isomerase; Provisional	100.0
cd02811		326	IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di	100.0
TIGR02151		333	IPP_isom_2 isopentenyl-diphosphate delta-isomerase	99.97
cd02809		299	alpha_hydroxyacid_oxid_FMN Family of homologous FM	99.96
PRK05458		326	guanosine 5'-monophosphate oxidoreductase; Provisi	99.88
TIGR01306		321	GMP_reduct_2 guanosine monophosphate reductase, ba	99.85
PRK06843		404	inosine 5-monophosphate dehydrogenase; Validated	99.77
cd00381		325	IMPDH IMPDH: The catalytic domain of the inosine m	99.77
PRK08649		368	inosine 5-monophosphate dehydrogenase; Validated	99.74
TIGR01305		343	GMP_reduct_1 guanosine monophosphate reductase, eu	99.72
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	99.69
PRK05096		346	guanosine 5'-monophosphate oxidoreductase; Provisi	99.67
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	99.65
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	99.63
PF03060		330	NMO: Nitronate monooxygenase; InterPro: IPR004136	99.61
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	99.61
PF00478		352	IMPDH: IMP dehydrogenase / GMP reductase domain; I	99.59
TIGR01304		369	IMP_DH_rel_2 IMP dehydrogenase family protein. Thi	99.59
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	99.57
PLN02274		505	inosine-5'-monophosphate dehydrogenase	99.56
COG2070		336	Dioxygenases related to 2-nitropropane dioxygenase	99.54
cd04743		320	NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma	99.52
TIGR03151		307	enACPred_II putative enoyl-(acyl-carrier-protein)	99.51
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	99.45
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	99.44
cd04742		418	NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom	99.39
PLN02826		409	dihydroorotate dehydrogenase	99.34
cd04739		325	DHOD_like Dihydroorotate dehydrogenase (DHOD) like	99.31
TIGR02814		444	pfaD_fam PfaD family protein. The protein PfaD is	99.29
TIGR01037		300	pyrD_sub1_fam dihydroorotate dehydrogenase (subfam	99.24
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c	99.17
KOG2550\|consensus		503		99.1
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	99.1
COG0167		310	PyrD Dihydroorotate dehydrogenase [Nucleotide tran	99.08
PRK05286		344	dihydroorotate dehydrogenase 2; Reviewed	99.01
cd02940		299	DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM	98.99
PLN02495		385	oxidoreductase, acting on the CH-CH group of donor	98.91
PRK02506		310	dihydroorotate dehydrogenase 1A; Reviewed	98.9
cd04738		327	DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl	98.89
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	98.86
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD)	98.85
TIGR01036		335	pyrD_sub2 dihydroorotate dehydrogenase, subfamily	98.84
cd04741		294	DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c	98.83
TIGR00736		231	nifR3_rel_arch TIM-barrel protein, putative. Membe	98.75
PF01180		295	DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP	98.55
TIGR00737		319	nifR3_yhdG putative TIM-barrel protein, nifR3 fami	98.54
PF04131		192	NanE: Putative N-acetylmannosamine-6-phosphate epi	98.53
cd02911		233	arch_FMN Archeal FMN-binding domain. This family o	98.52
PRK10415		321	tRNA-dihydrouridine synthase B; Provisional	98.5
cd02801		231	DUS_like_FMN Dihydrouridine synthase-like (DUS-lik	98.48
PRK01130		221	N-acetylmannosamine-6-phosphate 2-epimerase; Provi	98.46
cd04722		200	TIM_phosphate_binding TIM barrel proteins share a	98.38
PRK10550		312	tRNA-dihydrouridine synthase C; Provisional	98.37
cd04729		219	NanE N-acetylmannosamine-6-phosphate epimerase (Na	98.36
cd02803		327	OYE_like_FMN_family Old yellow enzyme (OYE)-like F	98.35
cd04730		236	NPD_like 2-Nitropropane dioxygenase (NPD), one of	98.32
COG3010		229	NanE Putative N-acetylmannosamine-6-phosphate epim	98.26
TIGR00742		318	yjbN tRNA dihydrouridine synthase A. Members of th	98.22
PRK11815		333	tRNA-dihydrouridine synthase A; Provisional	98.2
PF01207		309	Dus: Dihydrouridine synthase (Dus); InterPro: IPR0	98.1
cd02931		382	ER_like_FMN Enoate reductase (ER)-like FMN-binding	98.06
KOG1436\|consensus		398		98.04
COG0042		323	tRNA-dihydrouridine synthase [Translation, ribosom	98.03
cd02933		338	OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind	98.0
cd04728		248	ThiG Thiazole synthase (ThiG) is the tetrameric en	97.98
PRK00208		250	thiG thiazole synthase; Reviewed	97.98
PRK11750		1485	gltB glutamate synthase subunit alpha; Provisional	97.98
cd04735		353	OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN	97.97
PRK00507		221	deoxyribose-phosphate aldolase; Provisional	97.95
TIGR00343		287	pyridoxal 5'-phosphate synthase, synthase subunit	97.95
cd04734		343	OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN	97.94
cd04733		338	OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN	97.9
cd04727		283	pdxS PdxS is a subunit of the pyridoxal 5'-phospha	97.89
PRK13523		337	NADPH dehydrogenase NamA; Provisional	97.86
PRK05848		273	nicotinate-nucleotide pyrophosphorylase; Provision	97.78
KOG2335\|consensus		358		97.74
cd02930		353	DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin	97.73
TIGR00262		256	trpA tryptophan synthase, alpha subunit. Tryptopha	97.72
cd02932		336	OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN	97.71
PF04898		287	Glu_syn_central: Glutamate synthase central domain	97.71
COG1902		363	NemA NADH:flavin oxidoreductases, Old Yellow Enzym	97.7
PRK07695		201	transcriptional regulator TenI; Provisional	97.66
COG0274		228	DeoC Deoxyribose-phosphate aldolase [Nucleotide tr	97.65
PF05690		247	ThiG: Thiazole biosynthesis protein ThiG; InterPro	97.64
cd04731		243	HisF The cyclase subunit of imidazoleglycerol phos	97.63
cd00331		217	IGPS Indole-3-glycerol phosphate synthase (IGPS);	97.63
cd04732		234	HisA HisA. Phosphoribosylformimino-5-aminoimidazol	97.63
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	97.61
PF04481		242	DUF561: Protein of unknown function (DUF561); Inte	97.57
TIGR00126		211	deoC deoxyribose-phosphate aldolase. Deoxyribose-p	97.56
PRK13125		244	trpA tryptophan synthase subunit alpha; Provisiona	97.54
cd02929		370	TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH)	97.53
PRK01033		258	imidazole glycerol phosphate synthase subunit HisF	97.53
PRK13585		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.52
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	97.51
PRK08385		278	nicotinate-nucleotide pyrophosphorylase; Provision	97.47
TIGR00007		230	phosphoribosylformimino-5-aminoimidazole carboxami	97.46
CHL00162		267	thiG thiamin biosynthesis protein G; Validated	97.43
PRK04180		293	pyridoxal biosynthesis lyase PdxS; Provisional	97.41
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	97.41
cd00959		203	DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of	97.38
PRK14024		241	phosphoribosyl isomerase A; Provisional	97.38
CHL00200		263	trpA tryptophan synthase alpha subunit; Provisiona	97.37
cd04747		361	OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN	97.33
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	97.3
PRK00748		233	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.25
PRK00278		260	trpC indole-3-glycerol-phosphate synthase; Reviewe	97.25
PRK05283		257	deoxyribose-phosphate aldolase; Provisional	97.21
PRK00043		212	thiE thiamine-phosphate pyrophosphorylase; Reviewe	97.2
PRK10605		362	N-ethylmaleimide reductase; Provisional	97.19
cd04731		243	HisF The cyclase subunit of imidazoleglycerol phos	97.15
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	97.13
PRK02083		253	imidazole glycerol phosphate synthase subunit HisF	97.12
PF00724		341	Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox	97.08
PLN02411		391	12-oxophytodienoate reductase	97.07
PRK14024		241	phosphoribosyl isomerase A; Provisional	97.06
PRK11840		326	bifunctional sulfur carrier protein/thiazole synth	97.06
PRK02083		253	imidazole glycerol phosphate synthase subunit HisF	97.06
PRK07428		288	nicotinate-nucleotide pyrophosphorylase; Provision	97.04
PRK00748		233	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.01
PRK13111		258	trpA tryptophan synthase subunit alpha; Provisiona	96.99
TIGR01304		369	IMP_DH_rel_2 IMP dehydrogenase family protein. Thi	96.98
PRK08649		368	inosine 5-monophosphate dehydrogenase; Validated	96.95
cd04724		242	Tryptophan_synthase_alpha Ttryptophan synthase (TR	96.94
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	96.92
cd04726		202	KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl	96.91
PRK13587		234	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	96.9
PRK04302		223	triosephosphate isomerase; Provisional	96.9
cd04732		234	HisA HisA. Phosphoribosylformimino-5-aminoimidazol	96.84
cd00564		196	TMP_TenI Thiamine monophosphate synthase (TMP synt	96.82
cd04723		233	HisA_HisF Phosphoribosylformimino-5-aminoimidazole	96.82
COG0159		265	TrpA Tryptophan synthase alpha chain [Amino acid t	96.81
PRK07028		430	bifunctional hexulose-6-phosphate synthase/ribonuc	96.73
PF01729		169	QRPTase_C: Quinolinate phosphoribosyl transferase,	96.67
PLN02591		250	tryptophan synthase	96.66
PRK07896		289	nicotinate-nucleotide pyrophosphorylase; Provision	96.61
TIGR00734		221	hisAF_rel hisA/hisF family protein. This alignment	96.59
PLN02334		229	ribulose-phosphate 3-epimerase	96.56
cd00958		235	DhnA Class I fructose-1,6-bisphosphate (FBP) aldol	96.55
COG2022		262	ThiG Uncharacterized enzyme of thiazole biosynthes	96.55
cd01568		269	QPRTase_NadC Quinolinate phosphoribosyl transferas	96.51
PF00977		229	His_biosynth: Histidine biosynthesis protein; Inte	96.5
PRK05742		277	nicotinate-nucleotide pyrophosphorylase; Provision	96.5
COG0106		241	HisA Phosphoribosylformimino-5-aminoimidazole carb	96.5
cd01572		268	QPRTase Quinolinate phosphoribosyl transferase (QA	96.47
cd00945		201	Aldolase_Class_I Class I aldolases. The class I al	96.43
TIGR00078		265	nadC nicotinate-nucleotide pyrophosphorylase. Syno	96.42
PF00290		259	Trp_syntA: Tryptophan synthase alpha chain; InterP	96.39
TIGR01334		277	modD putative molybdenum utilization protein ModD.	96.34
PRK13585		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	96.33
cd01571		302	NAPRTase_B Nicotinate phosphoribosyltransferase (N	96.29
PRK06543		281	nicotinate-nucleotide pyrophosphorylase; Provision	96.29
PRK08883		220	ribulose-phosphate 3-epimerase; Provisional	96.28
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	96.26
PRK06106		281	nicotinate-nucleotide pyrophosphorylase; Provision	96.25
PRK08072		277	nicotinate-nucleotide pyrophosphorylase; Provision	96.23
PRK06559		290	nicotinate-nucleotide pyrophosphorylase; Provision	96.21
COG0157		280	NadC Nicotinate-nucleotide pyrophosphorylase [Coen	96.21
TIGR00693		196	thiE thiamine-phosphate pyrophosphorylase. This mo	96.2
PRK13587		234	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	96.18
PRK06096		284	molybdenum transport protein ModD; Provisional	96.17
cd00956		211	Transaldolase_FSA Transaldolase-like fructose-6-ph	96.13
TIGR01182		204	eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho	96.12
PRK04128		228	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	96.08
cd01573		272	modD_like ModD; Quinolinate phosphoribosyl transfe	96.08
PRK09016		296	quinolinate phosphoribosyltransferase; Validated	96.03
cd00429		211	RPE Ribulose-5-phosphate 3-epimerase (RPE). This e	96.03
COG0214		296	SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta	96.01
PLN02716		308	nicotinate-nucleotide diphosphorylase (carboxylati	95.93
PRK04169		232	geranylgeranylglyceryl phosphate synthase-like pro	95.92
PRK14114		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	95.89
cd04723		233	HisA_HisF Phosphoribosylformimino-5-aminoimidazole	95.88
PRK07226		267	fructose-bisphosphate aldolase; Provisional	95.82
PTZ00170		228	D-ribulose-5-phosphate 3-epimerase; Provisional	95.81
PRK01033		258	imidazole glycerol phosphate synthase subunit HisF	95.79
TIGR01163		210	rpe ribulose-phosphate 3-epimerase. This family co	95.76
TIGR02129		253	hisA_euk phosphoribosylformimino-5-aminoimidazole	95.72
PF00218		254	IGPS: Indole-3-glycerol phosphate synthase; InterP	95.71
cd02812		219	PcrB_like PcrB_like proteins. One member of this f	95.71
TIGR00007		230	phosphoribosylformimino-5-aminoimidazole carboxami	95.66
TIGR01949		258	AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep	95.57
PF01884		230	PcrB: PcrB family; InterPro: IPR008205 This entry	95.55
PF01791		236	DeoC: DeoC/LacD family aldolase; InterPro: IPR0029	95.54
cd00405		203	PRAI Phosphoribosylanthranilate isomerase (PRAI) c	95.52
TIGR01919		243	hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy	95.51
PRK06978		294	nicotinate-nucleotide pyrophosphorylase; Provision	95.44
PRK09140		206	2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R	95.44
TIGR00259		257	thylakoid_BtpA membrane complex biogenesis protein	95.39
PRK13802		695	bifunctional indole-3-glycerol phosphate synthase/	95.38
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family b	95.31
PRK13957		247	indole-3-glycerol-phosphate synthase; Provisional	95.3
PRK06843		404	inosine 5-monophosphate dehydrogenase; Validated	95.27
TIGR01305		343	GMP_reduct_1 guanosine monophosphate reductase, eu	95.26
PRK13586		232	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	95.21
PRK06512		221	thiamine-phosphate pyrophosphorylase; Provisional	95.15
COG0134		254	TrpC Indole-3-glycerol phosphate synthase [Amino a	95.11
PRK05581		220	ribulose-phosphate 3-epimerase; Validated	95.08
TIGR00875		213	fsa_talC_mipB fructose-6-phosphate aldolase, TalC/	95.04
TIGR01919		243	hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy	95.04
TIGR01769		205	GGGP geranylgeranylglyceryl phosphate synthase. Th	95.03
cd00381		325	IMPDH IMPDH: The catalytic domain of the inosine m	95.02
PF03437		254	BtpA: BtpA family; InterPro: IPR005137 Photosystem	95.02
PRK14114		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	95.0
PF00478		352	IMPDH: IMP dehydrogenase / GMP reductase domain; I	94.98
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family b	94.89
PRK02615		347	thiamine-phosphate pyrophosphorylase; Provisional	94.85
COG0107		256	HisF Imidazoleglycerol-phosphate synthase [Amino a	94.83
PF00977		229	His_biosynth: Histidine biosynthesis protein; Inte	94.81
PRK04128		228	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	94.79
COG4981		717	Enoyl reductase domain of yeast-type FAS1 [Lipid m	94.72
TIGR01768		223	GGGP-family geranylgeranylglyceryl phosphate synth	94.66
PRK13586		232	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	94.58
PRK01362		214	putative translaldolase; Provisional	94.33
PRK08227		264	autoinducer 2 aldolase; Validated	94.3
TIGR00640		132	acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal	94.27
PRK12653		220	fructose-6-phosphate aldolase; Reviewed	94.17
TIGR00734		221	hisAF_rel hisA/hisF family protein. This alignment	94.16
PRK07188		352	nicotinate phosphoribosyltransferase; Provisional	94.09
PRK09427		454	bifunctional indole-3-glycerol phosphate synthase/	94.04
cd04726		202	KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl	93.97
PRK06015		201	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	93.91
PLN02460		338	indole-3-glycerol-phosphate synthase	93.85
PRK08662		343	nicotinate phosphoribosyltransferase; Reviewed	93.83
PF02581		180	TMP-TENI: Thiamine monophosphate synthase/TENI; In	93.74
PRK09722		229	allulose-6-phosphate 3-epimerase; Provisional	93.71
cd00331		217	IGPS Indole-3-glycerol phosphate synthase (IGPS);	93.65
PLN02446		262	(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy	93.65
COG0352		211	ThiE Thiamine monophosphate synthase [Coenzyme met	93.56
cd00516		281	PRTase_typeII Phosphoribosyltransferase (PRTase) t	93.49
PRK07455		187	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	93.39
PRK05718		212	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	93.21
cd02072		128	Glm_B12_BD B12 binding domain of glutamate mutase	93.12
COG0269		217	SgbH 3-hexulose-6-phosphate synthase and related p	93.08
TIGR01306		321	GMP_reduct_2 guanosine monophosphate reductase, ba	93.0
PRK06552		213	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	92.99
COG0106		241	HisA Phosphoribosylformimino-5-aminoimidazole carb	92.91
PRK06552		213	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	92.89
PLN02446		262	(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy	92.81
KOG1606\|consensus		296		92.63
TIGR02134		236	transald_staph transaldolase. This small family of	92.59
PF01081		196	Aldolase: KDPG and KHG aldolase; InterPro: IPR0008	92.54
PRK13307		391	bifunctional formaldehyde-activating enzyme/3-hexu	92.52
PRK05096		346	guanosine 5'-monophosphate oxidoreductase; Provisi	92.48
PLN02417		280	dihydrodipicolinate synthase	92.34
TIGR02313		294	HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac	92.28
PRK08745		223	ribulose-phosphate 3-epimerase; Provisional	92.11
cd00951		289	KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also	92.06
PRK12656		222	fructose-6-phosphate aldolase; Reviewed	91.95
TIGR01859		282	fruc_bis_ald_ fructose-1,6-bisphosphate aldolase,	91.94
PRK13813		215	orotidine 5'-phosphate decarboxylase; Provisional	91.69
PRK08999		312	hypothetical protein; Provisional	91.68
PRK08091		228	ribulose-phosphate 3-epimerase; Validated	91.51
COG0107		256	HisF Imidazoleglycerol-phosphate synthase [Amino a	91.45
PRK12655		220	fructose-6-phosphate aldolase; Reviewed	91.31
PRK13306		216	ulaD 3-keto-L-gulonate-6-phosphate decarboxylase;	91.29
PLN02274		505	inosine-5'-monophosphate dehydrogenase	91.18
PRK03620		303	5-dehydro-4-deoxyglucarate dehydratase; Provisiona	91.17
PLN02495		385	oxidoreductase, acting on the CH-CH group of donor	91.01
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	91.0
PLN02617		538	imidazole glycerol phosphate synthase hisHF	90.97
cd00408		281	DHDPS-like Dihydrodipicolinate synthase family. A	90.82
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	90.71
PLN02617		538	imidazole glycerol phosphate synthase hisHF	90.64
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	90.61
COG2185		143	Sbm Methylmalonyl-CoA mutase, C-terminal domain/su	90.53
cd00952		309	CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate	90.5
PLN02898		502	HMP-P kinase/thiamin-monophosphate pyrophosphoryla	90.12
COG0269		217	SgbH 3-hexulose-6-phosphate synthase and related p	89.95
TIGR00683		290	nanA N-acetylneuraminate lyase. N-acetylneuraminat	89.78
PRK07114		222	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	89.56
PRK06852		304	aldolase; Validated	89.55
PRK03512		211	thiamine-phosphate pyrophosphorylase; Provisional	89.44
PRK00230		230	orotidine 5'-phosphate decarboxylase; Reviewed	89.33
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	89.25
PRK03903		274	transaldolase; Provisional	88.96
PRK04147		293	N-acetylneuraminate lyase; Provisional	88.81
PRK12376		236	putative translaldolase; Provisional	88.71
PRK09250		348	fructose-bisphosphate aldolase; Provisional	88.7
COG0329		299	DapA Dihydrodipicolinate synthase/N-acetylneuramin	88.65
COG1908		132	FrhD Coenzyme F420-reducing hydrogenase, delta sub	88.6
PRK14057		254	epimerase; Provisional	88.47
TIGR02129		253	hisA_euk phosphoribosylformimino-5-aminoimidazole	88.47
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	88.43
PRK05458		326	guanosine 5'-monophosphate oxidoreductase; Provisi	88.37
cd00954		288	NAL N-Acetylneuraminic acid aldolase, also called	88.19
PF00682		237	HMGL-like: HMGL-like of this family is not conserv	88.06
PRK13957		247	indole-3-glycerol-phosphate synthase; Provisional	88.02
TIGR03249		296	KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh	87.95
COG0176		239	MipB Transaldolase [Carbohydrate transport and met	87.94
PRK01130		221	N-acetylmannosamine-6-phosphate 2-epimerase; Provi	87.7
PRK06801		286	hypothetical protein; Provisional	87.69
TIGR00674		285	dapA dihydrodipicolinate synthase. Dihydrodipicoli	87.48
PF00834		201	Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam	87.42
cd04729		219	NanE N-acetylmannosamine-6-phosphate epimerase (Na	87.36
cd00950		284	DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke	87.28
TIGR01501		134	MthylAspMutase methylaspartate mutase, S subunit.	86.98
PRK08005		210	epimerase; Validated	86.85
PF02662		124	FlpD: Methyl-viologen-reducing hydrogenase, delta	86.63
cd02071		122	MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin	86.57
KOG1799\|consensus		471		86.5
COG1646		240	Predicted phosphate-binding enzymes, TIM-barrel fo	86.35
PRK06806		281	fructose-bisphosphate aldolase; Provisional	86.33
PRK05437		352	isopentenyl pyrophosphate isomerase; Provisional	86.19
cd04730		236	NPD_like 2-Nitropropane dioxygenase (NPD), one of	85.99
PRK07455		187	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	85.69
PF00701		289	DHDPS: Dihydrodipicolinate synthetase family; Inte	85.54
cd04743		320	NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma	85.33
PRK04180		293	pyridoxal biosynthesis lyase PdxS; Provisional	85.13
cd07940		268	DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-	85.0
PRK09426		714	methylmalonyl-CoA mutase; Reviewed	84.96
COG0036		220	Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate	84.92
KOG2334\|consensus		477		84.34
cd00377		243	ICL_PEPM Members of the ICL/PEPM enzyme family cat	84.25
PRK12290		437	thiE thiamine-phosphate pyrophosphorylase; Reviewe	83.65
cd04739		325	DHOD_like Dihydroorotate dehydrogenase (DHOD) like	83.56
PRK03170		292	dihydrodipicolinate synthase; Provisional	83.32
KOG3111\|consensus		224		83.03
cd00945		201	Aldolase_Class_I Class I aldolases. The class I al	82.62
COG0800		211	Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca	82.59
PRK13307		391	bifunctional formaldehyde-activating enzyme/3-hexu	82.53
COG0135		208	TrpF Phosphoribosylanthranilate isomerase [Amino a	82.51
COG0352		211	ThiE Thiamine monophosphate synthase [Coenzyme met	82.42
TIGR03151		307	enACPred_II putative enoyl-(acyl-carrier-protein)	82.41
PTZ00411		333	transaldolase-like protein; Provisional	82.18
cd03174		265	DRE_TIM_metallolyase DRE-TIM metallolyase superfam	82.11
PF04131		192	NanE: Putative N-acetylmannosamine-6-phosphate epi	81.64
PRK09517		755	multifunctional thiamine-phosphate pyrophosphoryla	81.57
cd00439		252	Transaldolase Transaldolase. Enzymes found in the	81.57
PRK00278		260	trpC indole-3-glycerol-phosphate synthase; Reviewe	81.12
TIGR00343		287	pyridoxal 5'-phosphate synthase, synthase subunit	80.93
cd02922		344	FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom	80.62
TIGR01182		204	eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho	80.34
PRK07315		293	fructose-bisphosphate aldolase; Provisional	80.33
KOG4201\|consensus		289		80.25
PRK02261		137	methylaspartate mutase subunit S; Provisional	80.15
PRK07114		222	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	80.14

>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism]	Back alignment and domain information

Probab=100.00  E-value=2.2e-99  Score=784.84  Aligned_cols=388  Identities=58%  Similarity=0.862  Sum_probs=373.5

Q ss_pred             CCCccceeeecCCcccccchhh-HHHHHHHh-cCCHHHHHHHHHHhhhccCccccccccccccCCC-CCCCCCCcccccc
Q psy10999          1 INKHYYYYFYKSITGLISKPFS-TDFQEAAS-NNNKNAYDRFRESNMESVKYSTLRGQLDFVTHDK-PVDISEVEPAAEI   77 (447)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~-~~~~~~v~~~~~i   77 (447)
                      ++.+|+|+||+.||+|.|+|.+ ..+|.+++ +++|..|++|+..+++.. ..++|++++|++..+ ++++++|+|..++
T Consensus        87 ~~~~G~~~~r~~ge~h~~~p~~~~~~q~a~~~~~~~~~~~~~~~~i~~~~-~~~~r~~~d~~~~~~~~i~~~~vep~~~i  165 (485)
T COG0069          87 LDVGGFGTERDGGEPHFYDPDTLFALQVATRSEGGYREYKEYSVLIGTRA-STTLRDLLDFIADGSKPIPIEEVEPVLEL  165 (485)
T ss_pred             ccccCcceecccCCCccCCHHHHhHhhhcccccCchHHHHHHHHHhhccc-chhhhhhhhhcccccccccccccccccee
Confidence            3567999999999999999999 99999999 789999999999998764 556999999998766 8999999999999


Q ss_pred             ccceeecCCCcccCcHHHHHHHHHHHHHhCCceeecCCCCChhhhhccCCCCCCCeEEeCCCCccccccccceeeccccc
Q psy10999         78 VKRFATGAMSFGSISIEAHTTLAKAMNKIGAKSNTGEGGENPERYLSSGDENQRSAIKQGKLYPKTYCFLSSLFTDLFPV  157 (447)
Q Consensus        78 ~~Pf~iaaMs~G~ls~ea~~aLA~AA~~~G~~~~sGeg~~~~e~~~~~~~~~~~~~i~Q~~ly~~~~~~~~lv~t~d~p~  157 (447)
                      .+||.+++||||++|+++|++||+||+++|+.+||||||++++++.     ...+.|+|                     
T Consensus       166 ~~~~~~~aMS~GAlS~eA~~alA~a~~~~G~~sntGEGGe~~~~~~-----~~~s~I~Q---------------------  219 (485)
T COG0069         166 KKRFVTGAMSFGALSKEAHEALARAMNRIGTKSNTGEGGEDPERYE-----DGRSAIKQ---------------------  219 (485)
T ss_pred             eecccccccCCccccHHHHHHHHHHHHHhcCcccCCCCCCCHHHhc-----cccceEEE---------------------
Confidence            9999999999999999999999999999999999999999999972     45789999                     


Q ss_pred             cccccccCCCCCChHhhccccccccccccccCCCCCCCCCCCcccHHHHhhcCCCCcccccCCCCCCCCCCHHHHHHHHH
Q psy10999        158 YGLPVASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTKDIASTRHSVPGVGLISPPPHHDIYSIEDLAELIY  237 (447)
Q Consensus       158 ~~~rv~s~rfGv~~~~l~~a~~ieik~~QgAkPg~gg~l~~~kv~~~ia~~r~~~~g~~lisp~~~~~~~s~edl~~~I~  237 (447)
                          ++|+||||+.+||.++++||||++||||||+||+||+.||+++|+++|+++||+++|||++||||||+|||+|+|+
T Consensus       220 ----vaSGRFGV~~~yL~~a~~ieIKiaQGAKPGeGG~Lpg~KV~~~IA~~R~~~pG~~~ISP~pHHDiysieDLaqlI~  295 (485)
T COG0069         220 ----VASGRFGVTPEYLANADAIEIKIAQGAKPGEGGQLPGEKVTPEIAKTRGSPPGVGLISPPPHHDIYSIEDLAQLIK  295 (485)
T ss_pred             ----eccccCccCHHHhCccceEEEEeccCCCCCCCCCCCCccCCHHHHHhcCCCCCCCCcCCCCcccccCHHHHHHHHH
Confidence                9999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhCCCCceEEEEeeeccHHHHHHHHHHCCCcEEEEecCCCCCCCccccccccCCCChHHHHHHHHHHHHhcCCCCce
Q psy10999        238 DLKCANPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLALNNLRSRV  317 (447)
Q Consensus       238 ~Lr~~~p~~pI~VKlv~~~Gi~~~A~~a~~aGaD~I~VsG~~GGtg~a~~~~~~~~G~p~~~~L~ev~~~l~~~glr~~v  317 (447)
                      +||++||.++|.||++++++++++|.++++++||+|+|||++||||++|+++++|+|+||+.+|++++|+|.++|+|++|
T Consensus       296 dLk~~~~~~~I~VKlva~~~v~~iaagvakA~AD~I~IdG~~GGTGAsP~~~~~~~GiP~e~glae~~q~L~~~glRd~v  375 (485)
T COG0069         296 DLKEANPWAKISVKLVAEHGVGTIAAGVAKAGADVITIDGADGGTGASPLTSIDHAGIPWELGLAETHQTLVLNGLRDKV  375 (485)
T ss_pred             HHHhcCCCCeEEEEEecccchHHHHhhhhhccCCEEEEcCCCCcCCCCcHhHhhcCCchHHHHHHHHHHHHHHcCCccee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEcCCCCChHHHHHHHHcCCCeeccChHHHHHhcccchhcccCCCCcccccccCHHHHhh--cCCcHHHHHHHHHHHH
Q psy10999        318 VLQADGQIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRKK--FAGKPEHVINYLFMLA  395 (447)
Q Consensus       318 ~viadGGIrtg~Dv~kAlaLGAd~V~iGt~~L~algc~~~~~c~~~~cP~giat~~~~l~~~--~~~g~~~V~~~l~~l~  395 (447)
                      .|++||||+|+.||+||++||||+|.+||++|+++||.|||+||+|+||+||+||||+||++  |.+++++|+||+..++
T Consensus       376 ~l~~~Ggl~Tg~DVaka~aLGAd~v~~gTa~lia~GCim~r~CH~~tCp~GIaTqdp~Lrkrl~~~~~~~~v~N~~~~~a  455 (485)
T COG0069         376 KLIADGGLRTGADVAKAAALGADAVGFGTAALVALGCIMCRVCHTGTCPVGIATQDPELRKRLDVEGKPERVINYFTFVA  455 (485)
T ss_pred             EEEecCCccCHHHHHHHHHhCcchhhhchHHHHHhhhHhhhhccCCCCCceeeecCHHHHhhcCccccHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999  7789999999999999


Q ss_pred             HHHHHHHhhhCCCCCCccccc--ccccc
Q psy10999        396 EEVSRDYRAESPGFDFPLVWL--GDFKQ  421 (447)
Q Consensus       396 ~Elr~~M~l~~~G~~s~~~l~--~~~~~  421 (447)
                      +|++++|+.  +|.+++.++.  .++++
T Consensus       456 ~e~rella~--lG~~~l~el~g~~d~L~  481 (485)
T COG0069         456 EELRELLAA--LGKRSLSELIGRTDLLR  481 (485)
T ss_pred             HHHHHHHHH--hCCCCHHHHhcchhhhh
Confidence            999999999  9999999987  55554

>KOG0399\|consensus	Back alignment and domain information

>PRK11750 gltB glutamate synthase subunit alpha; Provisional	Back alignment and domain information

>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots []	Back alignment and domain information

>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain	Back alignment and domain information

>KOG0538\|consensus	Back alignment and domain information

>PRK11197 lldD L-lactate dehydrogenase; Provisional	Back alignment and domain information

>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase	Back alignment and domain information

>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related	Back alignment and domain information

>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain	Back alignment and domain information

>PLN02979 glycolate oxidase	Back alignment and domain information

>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain	Back alignment and domain information

>TIGR02708 L_lactate_ox L-lactate oxidase	Back alignment and domain information

>PLN02535 glycolate oxidase	Back alignment and domain information

>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain	Back alignment and domain information

>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain	Back alignment and domain information

>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK05437 isopentenyl pyrophosphate isomerase; Provisional	Back alignment and domain information

>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain	Back alignment and domain information

>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2	Back alignment and domain information

>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes	Back alignment and domain information

>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial	Back alignment and domain information

>PRK06843 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>PRK08649 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase	Back alignment and domain information

>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only]	Back alignment and domain information

>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS)	Back alignment and domain information

>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD	Back alignment and domain information

>PLN02826 dihydroorotate dehydrogenase	Back alignment and domain information

>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins	Back alignment and domain information

>TIGR02814 pfaD_fam PfaD family protein	Back alignment and domain information

>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein	Back alignment and domain information

>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain	Back alignment and domain information

>KOG2550\|consensus	Back alignment and domain information

>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed	Back alignment and domain information

>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK05286 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>PLN02495 oxidoreductase, acting on the CH-CH group of donors	Back alignment and domain information

>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed	Back alignment and domain information

>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2	Back alignment and domain information

>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain	Back alignment and domain information

>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative	Back alignment and domain information

>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway	Back alignment and domain information

>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family	Back alignment and domain information

>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene []	Back alignment and domain information

>cd02911 arch_FMN Archeal FMN-binding domain	Back alignment and domain information

>PRK10415 tRNA-dihydrouridine synthase B; Provisional	Back alignment and domain information

>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain	Back alignment and domain information

>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional	Back alignment and domain information

>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>PRK10550 tRNA-dihydrouridine synthase C; Provisional	Back alignment and domain information

>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate	Back alignment and domain information

>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00742 yjbN tRNA dihydrouridine synthase A	Back alignment and domain information

>PRK11815 tRNA-dihydrouridine synthase A; Provisional	Back alignment and domain information

>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA	Back alignment and domain information

>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain	Back alignment and domain information

>KOG1436\|consensus	Back alignment and domain information

>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism	Back alignment and domain information

>PRK00208 thiG thiazole synthase; Reviewed	Back alignment and domain information

>PRK11750 gltB glutamate synthase subunit alpha; Provisional	Back alignment and domain information

>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4	Back alignment and domain information

>PRK00507 deoxyribose-phosphate aldolase; Provisional	Back alignment and domain information

>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1	Back alignment and domain information

>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3	Back alignment and domain information

>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2	Back alignment and domain information

>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa	Back alignment and domain information

>PRK13523 NADPH dehydrogenase NamA; Provisional	Back alignment and domain information

>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>KOG2335\|consensus	Back alignment and domain information

>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain	Back alignment and domain information

>TIGR00262 trpA tryptophan synthase, alpha subunit	Back alignment and domain information

>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain	Back alignment and domain information

>PF04898 Glu_syn_central: Glutamate synthase central domain; InterPro: IPR006982 Glutamate synthase (GltS)1 is a key enzyme in the early stages of the assimilation of ammonia in bacteria, yeasts, and plants	Back alignment and domain information

>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion]	Back alignment and domain information

>PRK07695 transcriptional regulator TenI; Provisional	Back alignment and domain information

>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences	Back alignment and domain information

>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water	Back alignment and domain information

>cd04732 HisA HisA	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae	Back alignment and domain information

>TIGR00126 deoC deoxyribose-phosphate aldolase	Back alignment and domain information

>PRK13125 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain	Back alignment and domain information

>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase	Back alignment and domain information

>CHL00162 thiG thiamin biosynthesis protein G; Validated	Back alignment and domain information

>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family	Back alignment and domain information

>PRK14024 phosphoribosyl isomerase A; Provisional	Back alignment and domain information

>CHL00200 trpA tryptophan synthase alpha subunit; Provisional	Back alignment and domain information

>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated	Back alignment and domain information

>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed	Back alignment and domain information

>PRK05283 deoxyribose-phosphate aldolase; Provisional	Back alignment and domain information

>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed	Back alignment and domain information

>PRK10605 N-ethylmaleimide reductase; Provisional	Back alignment and domain information

>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside []	Back alignment and domain information

>PLN02411 12-oxophytodienoate reductase	Back alignment and domain information

>PRK14024 phosphoribosyl isomerase A; Provisional	Back alignment and domain information

>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional	Back alignment and domain information

>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated	Back alignment and domain information

>PRK13111 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein	Back alignment and domain information

>PRK08649 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA)	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS)	Back alignment and domain information

>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK04302 triosephosphate isomerase; Provisional	Back alignment and domain information

>cd04732 HisA HisA	Back alignment and domain information

>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI	Back alignment and domain information

>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism]	Back alignment and domain information

>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated	Back alignment and domain information

>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2	Back alignment and domain information

>PLN02591 tryptophan synthase	Back alignment and domain information

>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>TIGR00734 hisAF_rel hisA/hisF family protein	Back alignment and domain information

>PLN02334 ribulose-phosphate 3-epimerase	Back alignment and domain information

>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea	Back alignment and domain information

>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism]	Back alignment and domain information

>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes	Back alignment and domain information

>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes	Back alignment and domain information

>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]	Back alignment and domain information

>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes	Back alignment and domain information

>cd00945 Aldolase_Class_I Class I aldolases	Back alignment and domain information

>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase	Back alignment and domain information

>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4	Back alignment and domain information

>TIGR01334 modD putative molybdenum utilization protein ModD	Back alignment and domain information

>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B	Back alignment and domain information

>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK08883 ribulose-phosphate 3-epimerase; Provisional	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism]	Back alignment and domain information

>TIGR00693 thiE thiamine-phosphate pyrophosphorylase	Back alignment and domain information

>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK06096 molybdenum transport protein ModD; Provisional	Back alignment and domain information

>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases	Back alignment and domain information

>TIGR01182 eda Entner-Doudoroff aldolase	Back alignment and domain information

>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport	Back alignment and domain information

>PRK09016 quinolinate phosphoribosyltransferase; Validated	Back alignment and domain information

>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE)	Back alignment and domain information

>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism]	Back alignment and domain information

>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating)	Back alignment and domain information

>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed	Back alignment and domain information

>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>PRK07226 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional	Back alignment and domain information

>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>TIGR01163 rpe ribulose-phosphate 3-epimerase	Back alignment and domain information

>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type	Back alignment and domain information

>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4	Back alignment and domain information

>cd02812 PcrB_like PcrB_like proteins	Back alignment and domain information

>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase	Back alignment and domain information

>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase	Back alignment and domain information

>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P)	Back alignment and domain information

>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism	Back alignment and domain information

>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP)	Back alignment and domain information

>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase	Back alignment and domain information

>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed	Back alignment and domain information

>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family	Back alignment and domain information

>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional	Back alignment and domain information

>cd00452 KDPG_aldolase KDPG and KHG aldolase	Back alignment and domain information

>PRK13957 indole-3-glycerol-phosphate synthase; Provisional	Back alignment and domain information

>PRK06843 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional	Back alignment and domain information

>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05581 ribulose-phosphate 3-epimerase; Validated	Back alignment and domain information

>TIGR00875 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/MipB family	Back alignment and domain information

>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase	Back alignment and domain information

>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase	Back alignment and domain information

>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane	Back alignment and domain information

>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase	Back alignment and domain information

>cd00452 KDPG_aldolase KDPG and KHG aldolase	Back alignment and domain information

>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional	Back alignment and domain information

>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes	Back alignment and domain information

>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>COG4981 Enoyl reductase domain of yeast-type FAS1 [Lipid metabolism]	Back alignment and domain information

>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein	Back alignment and domain information

>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK01362 putative translaldolase; Provisional	Back alignment and domain information

>PRK08227 autoinducer 2 aldolase; Validated	Back alignment and domain information

>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain	Back alignment and domain information

>PRK12653 fructose-6-phosphate aldolase; Reviewed	Back alignment and domain information

>TIGR00734 hisAF_rel hisA/hisF family protein	Back alignment and domain information

>PRK07188 nicotinate phosphoribosyltransferase; Provisional	Back alignment and domain information

>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional	Back alignment and domain information

>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS)	Back alignment and domain information

>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PLN02460 indole-3-glycerol-phosphate synthase	Back alignment and domain information

>PRK08662 nicotinate phosphoribosyltransferase; Reviewed	Back alignment and domain information

>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2	Back alignment and domain information

>PRK09722 allulose-6-phosphate 3-epimerase; Provisional	Back alignment and domain information

>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water	Back alignment and domain information

>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	Back alignment and domain information

>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism]	Back alignment and domain information

>cd00516 PRTase_typeII Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD	Back alignment and domain information

>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm)	Back alignment and domain information

>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial	Back alignment and domain information

>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	Back alignment and domain information

>KOG1606\|consensus	Back alignment and domain information

>TIGR02134 transald_staph transaldolase	Back alignment and domain information

>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4	Back alignment and domain information

>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional	Back alignment and domain information

>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>PLN02417 dihydrodipicolinate synthase	Back alignment and domain information

>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase	Back alignment and domain information

>PRK08745 ribulose-phosphate 3-epimerase; Provisional	Back alignment and domain information

>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases	Back alignment and domain information

>PRK12656 fructose-6-phosphate aldolase; Reviewed	Back alignment and domain information

>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist	Back alignment and domain information

>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional	Back alignment and domain information

>PRK08999 hypothetical protein; Provisional	Back alignment and domain information

>PRK08091 ribulose-phosphate 3-epimerase; Validated	Back alignment and domain information

>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12655 fructose-6-phosphate aldolase; Reviewed	Back alignment and domain information

>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional	Back alignment and domain information

>PLN02495 oxidoreductase, acting on the CH-CH group of donors	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PLN02617 imidazole glycerol phosphate synthase hisHF	Back alignment and domain information

>cd00408 DHDPS-like Dihydrodipicolinate synthase family	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>PLN02617 imidazole glycerol phosphate synthase hisHF	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism]	Back alignment and domain information

>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA)	Back alignment and domain information

>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase	Back alignment and domain information

>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00683 nanA N-acetylneuraminate lyase	Back alignment and domain information

>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK06852 aldolase; Validated	Back alignment and domain information

>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional	Back alignment and domain information

>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>PRK03903 transaldolase; Provisional	Back alignment and domain information

>PRK04147 N-acetylneuraminate lyase; Provisional	Back alignment and domain information

>PRK12376 putative translaldolase; Provisional	Back alignment and domain information

>PRK09250 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG1908 FrhD Coenzyme F420-reducing hydrogenase, delta subunit [Energy production and conversion]	Back alignment and domain information

>PRK14057 epimerase; Provisional	Back alignment and domain information

>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid)	Back alignment and domain information

>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members	Back alignment and domain information

>PRK13957 indole-3-glycerol-phosphate synthase; Provisional	Back alignment and domain information

>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase	Back alignment and domain information

>COG0176 MipB Transaldolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional	Back alignment and domain information

>PRK06801 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00674 dapA dihydrodipicolinate synthase	Back alignment and domain information

>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5	Back alignment and domain information

>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate	Back alignment and domain information

>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis	Back alignment and domain information

>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit	Back alignment and domain information

>PRK08005 epimerase; Validated	Back alignment and domain information

>PF02662 FlpD: Methyl-viologen-reducing hydrogenase, delta subunit; InterPro: IPR003813 Methyl-viologen-reducing hydrogenase (MVH) is one of the enzymes involved in methanogenesis and coded in the mth-flp-mvh-mrt cluster of methane genes in Methanothermobacter thermautotrophicus (Methanobacterium thermoformicicum) []	Back alignment and domain information

>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain	Back alignment and domain information

>KOG1799\|consensus	Back alignment and domain information

>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only]	Back alignment and domain information

>PRK06806 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PRK05437 isopentenyl pyrophosphate isomerase; Provisional	Back alignment and domain information

>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants	Back alignment and domain information

>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS)	Back alignment and domain information

>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional	Back alignment and domain information

>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK09426 methylmalonyl-CoA mutase; Reviewed	Back alignment and domain information

>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG2334\|consensus	Back alignment and domain information

>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage	Back alignment and domain information

>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed	Back alignment and domain information

>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins	Back alignment and domain information

>PRK03170 dihydrodipicolinate synthase; Provisional	Back alignment and domain information

>KOG3111\|consensus	Back alignment and domain information

>cd00945 Aldolase_Class_I Class I aldolases	Back alignment and domain information

>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional	Back alignment and domain information

>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism]	Back alignment and domain information

>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism]	Back alignment and domain information

>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II	Back alignment and domain information

>PTZ00411 transaldolase-like protein; Provisional	Back alignment and domain information

>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily	Back alignment and domain information

>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene []	Back alignment and domain information

>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional	Back alignment and domain information

>cd00439 Transaldolase Transaldolase	Back alignment and domain information

>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed	Back alignment and domain information

>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1	Back alignment and domain information

>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain	Back alignment and domain information

>TIGR01182 eda Entner-Doudoroff aldolase	Back alignment and domain information

>PRK07315 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>KOG4201\|consensus	Back alignment and domain information

>PRK02261 methylaspartate mutase subunit S; Provisional	Back alignment and domain information

>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		447
1ea0_A		1479	Alpha Subunit Of A. Brasilense Glutamate Synthase L		1e-100
2vdc_A		1472	The 9.5 A Resolution Structure Of Glutamate Synthas		1e-100
1llw_A		1520	Structural Studies On The Synchronization Of Cataly		1e-95

>pdb|1EA0|A Chain A, Alpha Subunit Of A. Brasilense Glutamate Synthase Length = 1479

Back alignment and structure

Iteration: 1

Score = 362 bits (929), Expect = e-100, Method: Compositional matrix adjust. Identities = 189/375 (50%), Positives = 240/375 (64%), Gaps = 27/375 (7%) Query: 25 FQEAASNNNKNAYDRFRESNMESVKYSTLRGQLDFVTHDKPVDISEVEPAAEIVKRFATG 84 Q+A +N++ + ++ E + LR L+ + PV + EVE I KRF T Sbjct: 798 LQQAVTNDSYTTFKKYSE-QVNKRPPMQLRDLLELRSTKAPVPVDEVESITAIRKRFITP 856 Query: 85 AMSFGSISIEAHTTLAKAMNKIGAKSNTGEGGENPERYLSSGD-ENQRSAIKQGKLYPKT 143 MS G++S EAH TL AMN+IGAKS++GEGGE+P R+ + +N SAIKQ Sbjct: 857 GMSMGALSPEAHGTLNVAMNRIGAKSDSGEGGEDPARFRPDKNGDNWNSAIKQ------- 909 Query: 144 YCFLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTK 203 VASGRFGVT+ YL +L+IK+AQGAKPGEGG+LPG+KVT+ Sbjct: 910 ------------------VASGRFGVTAEYLNQCRELEIKVAQGAKPGEGGQLPGFKVTE 951 Query: 204 DIASTRHSVPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARIXXXXXXXXXXXXXXX 263 IA RHS PGV LISPPPHHDIYSIEDLA+LIYDLK NP+A++ Sbjct: 952 MIARLRHSTPGVMLISPPPHHDIYSIEDLAQLIYDLKQINPDAKVTVKLVSRSGIGTIAA 1011 Query: 264 XXXXXXXEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLALNNLRSRVVLQADG 323 + I+ISG+ GGTGAS T IK AGLPWE+G++E HQVL LN LR RV L+ DG Sbjct: 1012 GVAKANADIILISGNSGGTGASPQTSIKFAGLPWEMGLSEVHQVLTLNRLRHRVRLRTDG 1071 Query: 324 QIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRKKFAGK 383 ++TG D+V+AA+LGA+E G+ TA LI MGC M+R+CH NTCPVG+ QD +LR+KF G Sbjct: 1072 GLKTGRDIVIAAMLGAEEFGIGTASLIAMGCIMVRQCHSNTCPVGVCVQDDKLRQKFVGT 1131 Query: 384 PEHVINYLFMLAEEV 398 PE V+N LAEEV Sbjct: 1132 PEKVVNLFTFLAEEV 1146

PyMOL of 1ea0

>pdb|2VDC|A Chain A, The 9.5 A Resolution Structure Of Glutamate Synthase From Cryo-Electron Microscopy And Its Oligomerization Behavior In Solution: Functional Implications. Length = 1472

Back alignment and structure

>pdb|1LLW|A Chain A, Structural Studies On The Synchronization Of Catalytic Centers In Glutamate Synthase: Complex With 2-Oxoglutarate Length = 1520

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		447
1ea0_A		1479	Glutamate synthase [NADPH] large chain; oxidoreduc	0.0
1ofd_A		1520	Ferredoxin-dependent glutamate synthase 2; oxidore	0.0
1vcf_A		332	Isopentenyl-diphosphate delta-isomerase; TIM barre	8e-07
3sr7_A		365	Isopentenyl-diphosphate delta-isomerase; isopenten	2e-05
1p0k_A		349	Isopentenyl-diphosphate delta-isomerase; terpene b	2e-05
3vkj_A		368	Isopentenyl-diphosphate delta-isomerase; type 2 is	2e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-04

>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Length = 1479	Back alignment and structure

 Score =  742 bits (1918), Expect = 0.0
 Identities = 206/382 (53%), Positives = 261/382 (68%), Gaps = 30/382 (7%)

Query: 26   QEAASNNNKNAYDRFRESNMESVKYSTLRGQLDFVTHDKPVDISEVEPAAEIVKRFATGA 85
            Q+A +N++   + ++ E  +       LR  L+  +   PV + EVE    I KRF T  
Sbjct: 799  QQAVTNDSYTTFKKYSEQ-VNKRPPMQLRDLLELRSTKAPVPVDEVESITAIRKRFITPG 857

Query: 86   MSFGSISIEAHTTLAKAMNKIGAKSNTGEGGENPERY--LSSGDENQRSAIKQGKLYPKT 143
            MS G++S EAH TL  AMN+IGAKS++GEGGE+P R+    +GD N  SAIKQ       
Sbjct: 858  MSMGALSPEAHGTLNVAMNRIGAKSDSGEGGEDPARFRPDKNGD-NWNSAIKQ------- 909

Query: 144  YCFLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTK 203
                              VASGRFGVT+ YL    +L+IK+AQGAKPGEGG+LPG+KVT+
Sbjct: 910  ------------------VASGRFGVTAEYLNQCRELEIKVAQGAKPGEGGQLPGFKVTE 951

Query: 204  DIASTRHSVPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARISVKLVSEVGVGVVAS 263
             IA  RHS PGV LISPPPHHDIYSIEDLA+LIYDLK  NP+A+++VKLVS  G+G +A+
Sbjct: 952  MIARLRHSTPGVMLISPPPHHDIYSIEDLAQLIYDLKQINPDAKVTVKLVSRSGIGTIAA 1011

Query: 264  GVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLALNNLRSRVVLQADG 323
            GVAK  A+ I+ISG+ GGTGAS  T IK AGLPWE+G++E HQVL LN LR RV L+ DG
Sbjct: 1012 GVAKANADIILISGNSGGTGASPQTSIKFAGLPWEMGLSEVHQVLTLNRLRHRVRLRTDG 1071

Query: 324  QIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRKKFAGK 383
             ++TG D+V+AA+LGA+E G+ TA LI MGC M+R+CH NTCPVG+  QD +LR+KF G 
Sbjct: 1072 GLKTGRDIVIAAMLGAEEFGIGTASLIAMGCIMVRQCHSNTCPVGVCVQDDKLRQKFVGT 1131

Query: 384  PEHVINYLFMLAEEVSRDYRAE 405
            PE V+N    LAEEV R+  A 
Sbjct: 1132 PEKVVNLFTFLAEEV-REILAG 1152

PyMOL of 1ea0

>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Length = 1520	Back alignment and structure

>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Length = 332	Back alignment and structure

>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Length = 365	Back alignment and structure

>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Length = 349	Back alignment and structure

>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Length = 368	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		447
1ofd_A		1520	Ferredoxin-dependent glutamate synthase 2; oxidore	100.0
1ea0_A		1479	Glutamate synthase [NADPH] large chain; oxidoreduc	100.0
3sgz_A		352	Hydroxyacid oxidase 2; flavoprotein, homology, INH	100.0
3sr7_A		365	Isopentenyl-diphosphate delta-isomerase; isopenten	100.0
2nli_A		368	Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid	100.0
2nzl_A		392	Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G	100.0
3vkj_A		368	Isopentenyl-diphosphate delta-isomerase; type 2 is	100.0
1kbi_A		511	Cytochrome B2, L-LCR; flavocytochrome B2, electron	100.0
1gox_A		370	(S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu	99.97
1p4c_A		380	L(+)-mandelate dehydrogenase; TIM barrel, hydroxy	99.97
1vcf_A		332	Isopentenyl-diphosphate delta-isomerase; TIM barre	99.97
1p0k_A		349	Isopentenyl-diphosphate delta-isomerase; terpene b	99.95
2c6q_A		351	GMP reductase 2; TIM barrel, metal-binding, NADP,	99.92
1ypf_A		336	GMP reductase; GUAC, purines, pyrimidines, nucleos	99.92
2qr6_A		393	IMP dehydrogenase/GMP reductase; NP_599840.1, G re	99.91
1eep_A		404	Inosine 5'-monophosphate dehydrogenase; alpha-beta	99.9
3r2g_A		361	Inosine 5'-monophosphate dehydrogenase; structural	99.84
1me8_A		503	Inosine-5'-monophosphate dehydrogenase; alpha beta	99.79
1vrd_A		494	Inosine-5'-monophosphate dehydrogenase; TM1347, st	99.77
4fo4_A		366	Inosine 5'-monophosphate dehydrogenase; structural	99.76
3usb_A		511	Inosine-5'-monophosphate dehydrogenase; structural	99.73
3ffs_A		400	Inosine-5-monophosphate dehydrogenase; beta-alpha	99.73
3khj_A		361	Inosine-5-monophosphate dehydrogenase; enzyme-inhi	99.72
1jcn_A		514	Inosine monophosphate dehydrogenase I; IMPD, IMPDH	99.68
4avf_A		490	Inosine-5'-monophosphate dehydrogenase; oxidoreduc	99.65
2cu0_A		486	Inosine-5'-monophosphate dehydrogenase; structural	99.63
4fxs_A		496	Inosine-5'-monophosphate dehydrogenase; structural	99.62
1zfj_A		491	Inosine monophosphate dehydrogenase; IMPDH, CBS do	99.62
4af0_A		556	Inosine-5'-monophosphate dehydrogenase; oxidoreduc	99.58
3i65_A		415	Dihydroorotate dehydrogenase homolog, mitochondria	99.38
3bo9_A		326	Putative nitroalkan dioxygenase; TM0800, structura	99.38
1jub_A		311	Dihydroorotate dehydrogenase A; homodimer, alpha-b	99.37
2e6f_A		314	Dihydroorotate dehydrogenase; chagas disease, pyri	99.34
3zwt_A		367	Dihydroorotate dehydrogenase (quinone), mitochond;	99.32
2z6i_A		332	Trans-2-enoyl-ACP reductase II; fatty acid synthes	99.28
1tv5_A		443	Dhodehase, dihydroorotate dehydrogenase homolog, m	99.27
1vhn_A		318	Putative flavin oxidoreducatase; structural genomi	99.27
1ep3_A		311	Dihydroorotate dehydrogenase B (PYRD subunit); het	99.25
1gte_A		1025	Dihydropyrimidine dehydrogenase; electron transfer	99.23
2gjl_A		328	Hypothetical protein PA1024; 2-nitropropane dioxyg	99.23
3bw2_A		369	2-nitropropane dioxygenase; TIM barrel, oxidoreduc	99.22
2uva_G		2060	Fatty acid synthase beta subunits; fungal, dehydra	99.19
4ef8_A		354	Dihydroorotate dehydrogenase; phenyl isothiocyanat	99.18
1f76_A		336	Dihydroorotate dehydrogenase; monomer, alpha-beta-	99.16
3oix_A		345	Putative dihydroorotate dehydrogenase; dihydrooro	99.16
2uv8_G		2051	Fatty acid synthase subunit beta (FAS1); fatty aci	99.02
3tjx_A		354	Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh	98.79
3zen_D		3089	Fatty acid synthase; transferase, mycolic acid bio	98.74
1mzh_A		225	Deoxyribose-phosphate aldolase; alpha-beta barrel,	98.71
3b0p_A		350	TRNA-dihydrouridine synthase; TIM barrel, oxidored	98.67
1y0e_A		223	Putative N-acetylmannosamine-6-phosphate 2-epimer;	98.65
1wv2_A		265	Thiazole moeity, thiazole biosynthesis protein THI	98.56
3q58_A		229	N-acetylmannosamine-6-phosphate 2-epimerase; TIM b	98.55
3igs_A		232	N-acetylmannosamine-6-phosphate 2-epimerase 2; ene	98.49
1yxy_A		234	Putative N-acetylmannosamine-6-phosphate 2-epimer;	98.42
3gr7_A		340	NADPH dehydrogenase; flavin, FMN, beta-alpha-barre	98.38
1z41_A		338	YQJM, probable NADH-dependent flavin oxidoreductas	98.32
3hgj_A		349	Chromate reductase; TIM barrel, oxidoreductase; HE	98.31
4adt_A		297	Pyridoxine biosynthetic enzyme PDX1 homologue, PU;	98.26
3ngj_A		239	Deoxyribose-phosphate aldolase; lyase, structural	98.25
3l5l_A		363	Xenobiotic reductase A; TIM barrel, oxidoreductase	98.22
2htm_A		268	Thiazole biosynthesis protein THIG; thiamin biosyn	98.15
3vnd_A		267	TSA, tryptophan synthase alpha chain; psychrophili	98.12
3kru_A		343	NADH:flavin oxidoreductase/NADH oxidase; homotetra	98.09
4ab4_A		362	Xenobiotic reductase B; oxidoreductase, OLD yellow	98.04
3nav_A		271	Tryptophan synthase alpha chain; alpha subunit, st	98.04
1xm3_A		264	Thiazole biosynthesis protein THIG; structural gen	98.0
2gou_A		365	Oxidoreductase, FMN-binding; OLD yeallow enzyme, f	97.99
3l5a_A		419	NADH/flavin oxidoreductase/NADH oxidase; OLD yello	97.93
3gka_A		361	N-ethylmaleimide reductase; decode biostructures,	97.91
3r12_A		260	Deoxyribose-phosphate aldolase; TIM beta/alpha-bar	97.91
3oa3_A		288	Aldolase; structural genomics, seattle structural	97.9
1vyr_A		364	Pentaerythritol tetranitrate reductase; oxidoreduc	97.89
3ndo_A		231	Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid	97.88
2nv1_A		305	Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b	97.84
2hsa_B		402	12-oxophytodienoate reductase 3; alpha beta 8 barr	97.83
3qja_A		272	IGPS, indole-3-glycerol phosphate synthase; struct	97.83
2r14_A		377	Morphinone reductase; H-tunnelling, flavoprotein,	97.82
1yad_A		221	Regulatory protein TENI; TIM barrel, transcription	97.8
3f4w_A		211	Putative hexulose 6 phosphate synthase; humps, mal	97.76
2ekc_A		262	AQ_1548, tryptophan synthase alpha chain; structur	97.75
3aty_A		379	Tcoye, prostaglandin F2A synthase; alpha/beta barr	97.73
1ub3_A		220	Aldolase protein; schiff base, deoxyribose phospha	97.73
1rd5_A		262	Tryptophan synthase alpha chain, chloroplast; hydr	97.72
1ps9_A		671	2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel	97.71
1icp_A		376	OPR1, 12-oxophytodienoate reductase 1; beta-alpha-	97.7
3tdn_A		247	FLR symmetric alpha-beta TIM barrel; symmetric sup	97.66
3tsm_A		272	IGPS, indole-3-glycerol phosphate synthase; struct	97.65
2zbt_A		297	Pyridoxal biosynthesis lyase PDXS; pyridoxine bios	97.64
1p1x_A		260	Deoxyribose-phosphate aldolase; alpha-beta barrel,	97.61
1vzw_A		244	Phosphoribosyl isomerase A; histidine biosynthesis	97.61
1o94_A		729	Tmadh, trimethylamine dehydrogenase; electron tran	97.61
1h5y_A		253	HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py	97.54
2yzr_A		330	Pyridoxal biosynthesis lyase PDXS; redox protein,	97.51
2y88_A		244	Phosphoribosyl isomerase A; aromatic amino acid bi	97.5
1qop_A		268	Tryptophan synthase alpha chain; lyase, carbon-oxy	97.49
1vcv_A		226	Probable deoxyribose-phosphate aldolase; DERA, hyp	97.47
1qo2_A		241	Molecule: N-((5-phosphoribosyl)-formimino)-5-amino	97.45
3k30_A		690	Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi	97.44
1thf_D		253	HISF protein; thermophIle, TIM-barrel, histidine b	97.4
2w6r_A		266	Imidazole glycerol phosphate synthase subunit HISF	97.39
2qjg_A		273	Putative aldolase MJ0400; beta-alpha barrel, lyase	97.38
1ka9_F		252	Imidazole glycerol phosphtate synthase; riken stru	97.36
2a4a_A		281	Deoxyribose-phosphate aldolase; lyase, TIM beta/al	97.31
1jvn_A		555	Glutamine, bifunctional histidine biosynthesis pro	97.3
1geq_A		248	Tryptophan synthase alpha-subunit; hyperthermophIl	97.28
3inp_A		246	D-ribulose-phosphate 3-epimerase; IDP02542, isomer	97.26
3o07_A		291	Pyridoxine biosynthesis protein SNZ1; (beta/alpha)	97.25
1xi3_A		215	Thiamine phosphate pyrophosphorylase; structural g	97.22
1n7k_A		234	Deoxyribose-phosphate aldolase; A.pernix, tetramer	97.22
1wa3_A		205	2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG,	97.2
3tdn_A		247	FLR symmetric alpha-beta TIM barrel; symmetric sup	97.14
3o63_A		243	Probable thiamine-phosphate pyrophosphorylase; thi	97.11
1ka9_F		252	Imidazole glycerol phosphtate synthase; riken stru	97.1
2p10_A		286	MLL9387 protein; putative phosphonopyruvate hydrol	97.06
1thf_D		253	HISF protein; thermophIle, TIM-barrel, histidine b	96.99
3ovp_A		228	Ribulose-phosphate 3-epimerase; iron binding, isom	96.98
1qap_A		296	Quinolinic acid phosphoribosyltransferase; glycosy	96.95
3vk5_A		286	MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S	96.92
2tps_A		227	Protein (thiamin phosphate synthase); thiamin bios	96.91
2y88_A		244	Phosphoribosyl isomerase A; aromatic amino acid bi	96.91
1qo2_A		241	Molecule: N-((5-phosphoribosyl)-formimino)-5-amino	96.89
2w6r_A		266	Imidazole glycerol phosphate synthase subunit HISF	96.83
2b7n_A		273	Probable nicotinate-nucleotide pyrophosphorylase;	96.78
1vzw_A		244	Phosphoribosyl isomerase A; histidine biosynthesis	96.77
3tqv_A		287	Nicotinate-nucleotide pyrophosphorylase; glycosylt	96.74
3vzx_A		228	Heptaprenylglyceryl phosphate synthase; biosynthes	96.73
2v82_A		212	2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l	96.72
2h6r_A		219	Triosephosphate isomerase; beta-alpha barrel; 2.30	96.69
3paj_A		320	Nicotinate-nucleotide pyrophosphorylase, carboxyl;	96.67
1h5y_A		253	HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py	96.67
3l0g_A		300	Nicotinate-nucleotide pyrophosphorylase; ssgcid, N	96.66
1ujp_A		271	Tryptophan synthase alpha chain; riken structural	96.66
2agk_A		260	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me	96.65
1i4n_A		251	Indole-3-glycerol phosphate synthase; thermostable	96.65
3jr2_A		218	Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon	96.64
3tjl_A		407	NADPH dehydrogenase; OLD yellow enzyme, flavin mon	96.63
3glc_A		295	Aldolase LSRF; TIM barrel, lyase, schiff base; HET	96.63
2jbm_A		299	Nicotinate-nucleotide pyrophosphorylase; NAD, enzy	96.6
2qr6_A		393	IMP dehydrogenase/GMP reductase; NP_599840.1, G re	96.56
1h1y_A		228	D-ribulose-5-phosphate 3-epimerase; oxidative pent	96.46
1ofd_A		1520	Ferredoxin-dependent glutamate synthase 2; oxidore	96.38
1vc4_A		254	Indole-3-glycerol phosphate synthase; lyase, trypt	96.38
3gnn_A		298	Nicotinate-nucleotide pyrophosphorylase; decode bi	96.37
4a29_A		258	Engineered retro-aldol enzyme RA95.0; de novo prot	96.36
1x1o_A		286	Nicotinate-nucleotide pyrophosphorylase; transfera	96.29
1ea0_A		1479	Glutamate synthase [NADPH] large chain; oxidoreduc	96.27
3kts_A		192	Glycerol uptake operon antiterminator regulatory;	96.25
4a3u_A		358	NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET	96.22
3c2e_A		294	Nicotinate-nucleotide pyrophosphorylase; qprtase,	96.2
3ajx_A		207	3-hexulose-6-phosphate synthase; HPS, OMPDC supraf	96.12
3khj_A		361	Inosine-5-monophosphate dehydrogenase; enzyme-inhi	96.1
1qpo_A		284	Quinolinate acid phosphoribosyl transferase; type	96.08
1rpx_A		230	Protein (ribulose-phosphate 3-epimerase); chloropl	96.08
1o4u_A		285	Type II quinolic acid phosphoribosyltransferase; s	96.06
1q6o_A		216	Humps, 3-keto-L-gulonate 6-phosphate decarboxylase	96.03
1w8s_A		263	FBP aldolase, fructose-bisphosphate aldolase class	96.0
2f6u_A		234	GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy	96.0
1pii_A		452	N-(5'phosphoribosyl)anthranilate isomerase; bifunc	95.97
1tqj_A		230	Ribulose-phosphate 3-epimerase; beta-alpha barrel	95.83
3s1x_A		223	Probable transaldolase; alpha-beta barrel, conform	95.83
4e38_A		232	Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho	95.7
4eiv_A		297	Deoxyribose-phosphate aldolase; chemotherapy, brai	95.69
2fli_A		220	Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr	95.65
1viz_A		240	PCRB protein homolog; structural genomics, unknown	95.6
3tha_A		252	Tryptophan synthase alpha chain; structural genomi	95.47
3ceu_A		210	Thiamine phosphate pyrophosphorylase; TIM barrel-l	95.4
3lab_A		217	Putative KDPG (2-keto-3-deoxy-6-phosphogluconate)	95.37
3cwo_X		237	Beta/alpha-barrel protein based on 1THF and 1TMY;	95.35
4fo4_A		366	Inosine 5'-monophosphate dehydrogenase; structural	95.3
4gbu_A		400	NADPH dehydrogenase 1; alpha/beta barrel, enenone	94.88
2yw3_A		207	4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox	94.87
3r8r_A		212	Transaldolase; pentose phosphate pathway, schiff b	94.75
1vpx_A		230	Protein (transaldolase (EC 2.2.1.2)); TM0295, stru	94.63
1vhc_A		224	Putative KHG/KDPG aldolase; structural genomics, u	94.61
1wbh_A		214	KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli}	94.53
4gj1_A		243	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me	94.51
2czd_A		208	Orotidine 5'-phosphate decarboxylase; pyrimidine b	94.42
1to3_A		304	Putative aldolase YIHT; beta-alpha barrel, structu	94.36
3f4w_A		211	Putative hexulose 6 phosphate synthase; humps, mal	94.23
1l6w_A		220	Fructose-6-phosphate aldolase 1; alpha-beta barrel	94.22
1hg3_A		225	Triosephosphate isomerase; thermostability, tetram	94.08
1w0m_A		226	TIM, triosephosphate isomerase; glycolysis, glucon	94.02
1mxs_A		225	KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a	94.02
3r2g_A		361	Inosine 5'-monophosphate dehydrogenase; structural	93.89
1tqx_A		227	D-ribulose-5-phosphate 3-epimerase, putative; stru	93.88
3ctl_A		231	D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p	93.88
1zfj_A		491	Inosine monophosphate dehydrogenase; IMPDH, CBS do	93.72
3nl6_A		540	Thiamine biosynthetic bifunctional enzyme; thiamin	93.56
2i1o_A		398	Nicotinate phosphoribosyltransferase; ZIN ION, zin	93.53
1vkf_A		188	Glycerol uptake operon antiterminator-related Pro;	93.52
1jvn_A		555	Glutamine, bifunctional histidine biosynthesis pro	93.46
3w01_A		235	Heptaprenylglyceryl phosphate synthase; biosynthes	93.4
3ih1_A		305	Methylisocitrate lyase; alpha-beta structure, TIM-	93.35
1wx0_A		223	Transaldolase; structural genomics, riken structur	93.19
2gjl_A		328	Hypothetical protein PA1024; 2-nitropropane dioxyg	93.14
2agk_A		260	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me	92.91
4e38_A		232	Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho	92.81
4gj1_A		243	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me	92.67
1xg4_A		295	Probable methylisocitrate lyase; 2-methylisocitrat	92.45
3bo9_A		326	Putative nitroalkan dioxygenase; TM0800, structura	92.25
3ffs_A		400	Inosine-5-monophosphate dehydrogenase; beta-alpha	92.09
1zlp_A		318	PSR132, petal death protein; TIM-barrel, helix swa	91.98
3jr2_A		218	Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon	91.88
2z6i_A		332	Trans-2-enoyl-ACP reductase II; fatty acid synthes	91.28
3bw2_A		369	2-nitropropane dioxygenase; TIM barrel, oxidoreduc	91.03
2wkj_A		303	N-acetylneuraminate lyase; directed evolution, sia	90.87
1vc4_A		254	Indole-3-glycerol phosphate synthase; lyase, trypt	90.8
3daq_A		292	DHDPS, dihydrodipicolinate synthase; lysine biosyn	90.76
2yw3_A		207	4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox	90.69
3cpr_A		304	Dihydrodipicolinate synthetase; (beta/alpha)8-barr	90.68
3iv3_A		332	Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p	90.65
3b4u_A		294	Dihydrodipicolinate synthase; structural genomics,	90.6
3qja_A		272	IGPS, indole-3-glycerol phosphate synthase; struct	90.59
3flu_A		297	DHDPS, dihydrodipicolinate synthase; TIM barrel, b	90.5
1xky_A		301	Dihydrodipicolinate synthase; TIM barrel, , lysine	90.47
3tak_A		291	DHDPS, dihydrodipicolinate synthase; TIM barrel, l	90.45
3ve9_A		215	Orotidine-5'-phosphate decarboxylase; TIM barrel f	90.44
2r8w_A		332	AGR_C_1641P; APC7498, dihydrodipicolinate synthase	90.41
1vhc_A		224	Putative KHG/KDPG aldolase; structural genomics, u	90.39
3l21_A		304	DHDPS, dihydrodipicolinate synthase; DAPA, dimer,	90.32
2ehh_A		294	DHDPS, dihydrodipicolinate synthase; structural ge	90.26
1f6k_A		293	N-acetylneuraminate lyase; beta barrel; 1.60A {Hae	90.2
3tsm_A		272	IGPS, indole-3-glycerol phosphate synthase; struct	90.16
2yxg_A		289	DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b	90.1
3si9_A		315	DHDPS, dihydrodipicolinate synthase; structural ge	90.03
3exr_A		221	RMPD (hexulose-6-phosphate synthase); beta barrel,	89.82
1ypf_A		336	GMP reductase; GUAC, purines, pyrimidines, nucleos	89.64
3na8_A		315	Putative dihydrodipicolinate synthetase; lyase; HE	89.59
3m5v_A		301	DHDPS, dihydrodipicolinate synthase; TIM barrel, c	89.54
3usb_A		511	Inosine-5'-monophosphate dehydrogenase; structural	89.47
3qze_A		314	DHDPS, dihydrodipicolinate synthase; alpha beta ba	89.32
2v9d_A		343	YAGE; dihydrodipicolinic acid synthase, N-acetyl n	89.19
3e96_A		316	Dihydrodipicolinate synthase; structural genomics,	89.12
1dbt_A		239	Orotidine 5'-phosphate decarboxylase; UMP, TIM bar	89.12
3q58_A		229	N-acetylmannosamine-6-phosphate 2-epimerase; TIM b	89.08
3cu2_A		237	Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib	89.08
3dz1_A		313	Dihydrodipicolinate synthase; lysine biosynthesis,	88.68
2rfg_A		297	Dihydrodipicolinate synthase; beta barrel, amino-a	88.64
3s5o_A		307	4-hydroxy-2-oxoglutarate aldolase, mitochondrial;	88.6
3h5d_A		311	DHDPS, dihydrodipicolinate synthase; lysine biosyn	88.59
3qfe_A		318	Putative dihydrodipicolinate synthase family PROT;	88.33
3igs_A		232	N-acetylmannosamine-6-phosphate 2-epimerase 2; ene	88.24
1wbh_A		214	KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli}	88.23
1o5k_A		306	DHDPS, dihydrodipicolinate synthase; TM1521, struc	88.18
4avf_A		490	Inosine-5'-monophosphate dehydrogenase; oxidoreduc	88.1
3ezx_A		215	MMCP 1, monomethylamine corrinoid protein 1; N ter	87.96
3d0c_A		314	Dihydrodipicolinate synthase; lysine biosynthesis,	87.82
3ajx_A		207	3-hexulose-6-phosphate synthase; HPS, OMPDC supraf	87.47
4dbe_A		222	Orotidine 5'-phosphate decarboxylase; TIM barrel,	87.42
3kp1_A		763	D-ornithine aminomutase E component; 5 aminomutase	87.21
2yxb_A		161	Coenzyme B12-dependent mutase; alpha/beta, structu	87.08
2ojp_A		292	DHDPS, dihydrodipicolinate synthase; dimer, lysine	86.98
3lab_A		217	Putative KDPG (2-keto-3-deoxy-6-phosphogluconate)	86.91
2vc6_A		292	MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar	86.8
1eix_A		245	Orotidine 5'-monophosphate decarboxylase; alpha-be	86.36
3fkr_A		309	L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f	86.16
3b8i_A		287	PA4872 oxaloacetate decarboxylase; alpha/beta barr	86.01
4dpp_A		360	DHDPS 2, dihydrodipicolinate synthase 2, chloropla	85.24
1ccw_A		137	Protein (glutamate mutase); coenzyme B12, radical	85.12
2i14_A		395	Nicotinate-nucleotide pyrophosphorylase; ligand bi	85.08
1jcn_A		514	Inosine monophosphate dehydrogenase I; IMPD, IMPDH	84.64
4aaj_A		228	N-(5'-phosphoribosyl)anthranilate isomerase; alpha	84.25
1s2w_A		295	Phosphoenolpyruvate phosphomutase; phosphonopyruva	84.02
1eep_A		404	Inosine 5'-monophosphate dehydrogenase; alpha-beta	83.79
3a5f_A		291	Dihydrodipicolinate synthase; TIM barrel, enzyme,	83.76
1v5x_A		203	PRA isomerase, phosphoribosylanthranilate isomeras	83.55
3eb2_A		300	Putative dihydrodipicolinate synthetase; lysine bi	83.54
1p0k_A		349	Isopentenyl-diphosphate delta-isomerase; terpene b	83.5
4fxs_A		496	Inosine-5'-monophosphate dehydrogenase; structural	83.24
1xrs_B		262	D-lysine 5,6-aminomutase beta subunit; TIM barrel,	83.09
2xij_A		762	Methylmalonyl-COA mutase, mitochondrial; isomerase	82.6
1mxs_A		225	KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a	82.08
3eoo_A		298	Methylisocitrate lyase; seattle structural genomic	81.99
4adt_A		297	Pyridoxine biosynthetic enzyme PDX1 homologue, PU;	81.6
3iwp_A		287	Copper homeostasis protein CUTC homolog; conserved	81.56
3gk0_A		278	PNP synthase, pyridoxine 5'-phosphate synthase; de	80.77
2pgw_A		384	Muconate cycloisomerase; enolase superfamily, octa	80.64
3ble_A		337	Citramalate synthase from leptospira interrogans;	80.56
2hmc_A		344	AGR_L_411P, dihydrodipicolinate synthase; alpha-be	80.47

>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A*	Back alignment and structure

Probab=100.00  E-value=1.4e-81  Score=719.91  Aligned_cols=408  Identities=49%  Similarity=0.806  Sum_probs=378.8

Q ss_pred             CCCccceeeecCCcccccchhh-HHHHHHHhc----------CCHHHHHHHHHHhhhccCccccccccccccCCCCCCCC
Q psy10999          1 INKHYYYYFYKSITGLISKPFS-TDFQEAASN----------NNKNAYDRFRESNMESVKYSTLRGQLDFVTHDKPVDIS   69 (447)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~   69 (447)
                      |+.+|+|+||++||+|.|+|++ +.||+++++          ++|+.|++|++.+++ .+++++|+++.|+.+.|+++++
T Consensus       780 l~~~g~~~~r~~ge~h~~~p~~i~~l~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~r~l~~~~~~~~~i~~~  858 (1520)
T 1ofd_A          780 LENFGFVNYRPGGEYHMNSPEMSKSLHKAVAAYKVGGNGNNGEAYDHYELYRQYLKD-RPVTALRDLLDFNADQPAISLE  858 (1520)
T ss_dssp             CCCCSSSSCCTTSSCCSCCHHHHHHHHHHHHHC------------CHHHHHHHHHHT-CCSCSGGGGEEECCSSCCCCGG
T ss_pred             CCCCCeeecCCCCCCCCCCHHHHHHHHHHHhcccCcccccccCCHHHHHHHHhhhcC-CCCcchhhhccccCCCCCCCch
Confidence            5789999999999999999999 999999999          899999999999987 5789999999999888999999


Q ss_pred             CCccccccccceeecCCCcccCcHHHHHHHHHHHHHhCCceeecCCCCChhhhhc-------------------cCCCCC
Q psy10999         70 EVEPAAEIVKRFATGAMSFGSISIEAHTTLAKAMNKIGAKSNTGEGGENPERYLS-------------------SGDENQ  130 (447)
Q Consensus        70 ~v~~~~~i~~Pf~iaaMs~G~ls~ea~~aLA~AA~~~G~~~~sGeg~~~~e~~~~-------------------~~~~~~  130 (447)
                      |||+..+|.+||+++|||+|++|++++++||+||+++|+.+++|||+++++++..                   .+++..
T Consensus       859 ev~~~~~I~~Pfii~aMS~GslS~ea~~aLA~Aas~aGg~~~tGeGg~~pe~~~~eir~~~~~~~~~~p~~~~~~nG~~~  938 (1520)
T 1ofd_A          859 EVESVESIVKRFCTGGMSLGALSREAHETLAIAMNRLGAKSNSGEGGEDVVRYLTLDDVDSEGNSPTLPHLHGLQNGDTA  938 (1520)
T ss_dssp             GSCCHHHHHTTEECCCBCTTTSCHHHHHHHHHHHHHHTCBCEECTTCCCGGGGSCCCCCCTTSCCTTSTTCCSCCTTCCC
T ss_pred             hhcccccccCceEecCcCcccccHHHHHHHHHHHHHcCCceEeCCCCCCHHHHHhhhccccccccccccccccccCcchH
Confidence            9999999999999999999999999999999999999999999999999988630                   001112


Q ss_pred             CCeEEeCCCCccccccccceeeccccccccccccCCCCCChHhhccccccccccccccCCCCCCCCCCCcccHHHHhhcC
Q psy10999        131 RSAIKQGKLYPKTYCFLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTKDIASTRH  210 (447)
Q Consensus       131 ~~~i~Q~~ly~~~~~~~~lv~t~d~p~~~~rv~s~rfGv~~~~l~~a~~ieik~~QgAkPg~gg~l~~~kv~~~ia~~r~  210 (447)
                      ...++|                         +++++||++.+++.++++||||++||||||+||+||+.||.++++.+|+
T Consensus       939 ~~~I~Q-------------------------l~sg~FGVn~~~l~~ad~IeIKi~QGAKpG~GG~Lp~~kV~~~iA~~R~  993 (1520)
T 1ofd_A          939 NSAIKQ-------------------------IASGRFGVTPEYLMSGKQLEIKMAQGAKPGEGGQLPGKKVSEYIAMLRR  993 (1520)
T ss_dssp             CCSEEE-------------------------ECTTCTTCCHHHHHHCSEEEEECCCTTSTTSCCEECGGGCCHHHHHHHT
T ss_pred             HHHHHH-------------------------hcCCCCccChhhccchHHHHHHHhccCCCCCCCCCCHHHHHHHHHHHcC
Confidence            345667                         9999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccccCCCCCCCCCCHHHHHHHHHHHHHhCCCCceEEEEeeeccHHHHHHHHHHCCCcEEEEecCCCCCCCcccccc
Q psy10999        211 SVPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGI  290 (447)
Q Consensus       211 ~~~g~~lisp~~~~~~~s~edl~~~I~~Lr~~~p~~pI~VKlv~~~Gi~~~A~~a~~aGaD~I~VsG~~GGtg~a~~~~~  290 (447)
                      +++|+++++|++||+|++++++.++|++||+.+|++||+||+++.+|++++|..++++|||+|+|||++|||+++|..+.
T Consensus       994 ~~~Gv~lisP~~~~d~~s~edl~~~I~~Lk~~~~~~PV~VKlv~~~gi~~~A~~a~kAGAD~IvVsG~eGGTgasp~~~~ 1073 (1520)
T 1ofd_A          994 SKPGVTLISPPPHHDIYSIEDLAQLIYDLHQINPEAQVSVKLVAEIGIGTIAAGVAKANADIIQISGHDGGTGASPLSSI 1073 (1520)
T ss_dssp             SCTTCCEECCSSCTTCSSHHHHHHHHHHHHHHCTTSEEEEEEECSTTHHHHHHHHHHTTCSEEEEECTTCCCSSEEHHHH
T ss_pred             CCCCCCeeCCCCCcCcCCHHHHHHHHHHHHHhCCCCCEEEEecCCCChHHHHHHHHHcCCCEEEEeCCCCccCCCcchhh
Confidence            99999999999999999999999999999999999999999999889999999999999999999999999999999889


Q ss_pred             ccCCCChHHHHHHHHHHHHhcCCCCceEEEEcCCCCChHHHHHHHHcCCCeeccChHHHHHhcccchhcccCCCCccccc
Q psy10999        291 KNAGLPWELGVAETHQVLALNNLRSRVVLQADGQIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIA  370 (447)
Q Consensus       291 ~~~G~p~~~~L~ev~~~l~~~glr~~v~viadGGIrtg~Dv~kAlaLGAd~V~iGt~~L~algc~~~~~c~~~~cP~gia  370 (447)
                      +++|+||+.+|+++++++.++|+|++||||+||||+||.||+||++||||+|++||+||++++|.|||+||+|+||+||+
T Consensus      1074 ~~~GlPt~~aL~ev~~al~~~glr~~IpVIAdGGIrtG~DVakALaLGAdaV~iGTafL~algc~~~r~Ch~~~CP~Gva 1153 (1520)
T 1ofd_A         1074 KHAGSPWELGVTEVHRVLMENQLRDRVLLRADGGLKTGWDVVMAALMGAEEYGFGSIAMIAEGCIMARVCHTNNCPVGVA 1153 (1520)
T ss_dssp             HHBCCCHHHHHHHHHHHHHHTTCGGGCEEEEESSCCSHHHHHHHHHTTCSEEECSHHHHHHTTCCCCCCGGGTCCTTSSS
T ss_pred             cCCchhHHHHHHHHHHHHHhcCCCCCceEEEECCCCCHHHHHHHHHcCCCeeEEcHHHHHHHHHHHHHhccCCCCCceeE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCHHHHhhcCCcHHHHHHHHHHHHHHHHHHHhhhCCCCCCccccc--cccccccccccc-cccccccccc
Q psy10999        371 TQDPELRKKFAGKPEHVINYLFMLAEEVSRDYRAESPGFDFPLVWL--GDFKQEGDQLSL-VWGTLTMKVT  438 (447)
Q Consensus       371 t~~~~l~~~~~~g~~~V~~~l~~l~~Elr~~M~l~~~G~~s~~~l~--~~~~~~~~~~~~-~~~~~~~~~~  438 (447)
                      ||+|+|+++|.+++++|.||++.|.+||+++|++  +|++++.++.  .+++...  .++ +||+..+|++
T Consensus      1154 tqdp~L~~~~~gg~e~V~n~l~~l~~ELr~~Ma~--lG~~si~eL~gr~dll~~~--~~~~~~~~~~ldl~ 1220 (1520)
T 1ofd_A         1154 TQQERLRQRFKGVPGQVVNFFYFIAEEVRSLLAH--LGYRSLDDIIGRTDLLKVR--SDVQLSKTQNLTLD 1220 (1520)
T ss_dssp             CCCHHHHTTCCCCHHHHHHHHHHHHHHHHHHHHH--HTCSCGGGTTTCGGGEEEC--SSCCCSSSSCCCCH
T ss_pred             eeCHHHHhhcCCcHHHHHHHHHHHHHHHHHHHHH--hCCCCHHHHhCcceEEecc--cccccHhhcCCCHH
Confidence            9999999999999999999999999999999999  9999999983  4555432  234 8999888875

PyMOL of 1ofd

>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A*	Back alignment and structure

>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A*	Back alignment and structure

>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans}	Back alignment and structure

>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A*	Back alignment and structure

>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A*	Back alignment and structure

>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A*	Back alignment and structure

>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A*	Back alignment and structure

>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0	Back alignment and structure

>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A*	Back alignment and structure

>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A*	Back alignment and structure

>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A*	Back alignment and structure

>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A*	Back alignment and structure

>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A*	Back alignment and structure

>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1	Back alignment and structure

>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp}	Back alignment and structure

>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A*	Back alignment and structure

>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1	Back alignment and structure

>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A	Back alignment and structure

>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A*	Back alignment and structure

>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum}	Back alignment and structure

>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum}	Back alignment and structure

>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A*	Back alignment and structure

>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa}	Back alignment and structure

>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1	Back alignment and structure

>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor}	Back alignment and structure

>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1	Back alignment and structure

>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B*	Back alignment and structure

>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A*	Back alignment and structure

>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8}	Back alignment and structure

>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A*	Back alignment and structure

>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A*	Back alignment and structure

>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ...	Back alignment and structure

>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A*	Back alignment and structure

>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1	Back alignment and structure

>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1	Back alignment and structure

>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A*	Back alignment and structure

>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A*	Back alignment and structure

>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A*	Back alignment and structure

>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A*	Back alignment and structure

>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G*	Back alignment and structure

>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A*	Back alignment and structure

>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1	Back alignment and structure

>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans}	Back alignment and structure

>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G*	Back alignment and structure

>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A*	Back alignment and structure

>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A*	Back alignment and structure

>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1	Back alignment and structure

>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C*	Back alignment and structure

>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5	Back alignment and structure

>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1	Back alignment and structure

>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp}	Back alignment and structure

>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0	Back alignment and structure

>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5	Back alignment and structure

>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A*	Back alignment and structure

>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A*	Back alignment and structure

>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A*	Back alignment and structure

>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A	Back alignment and structure

>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica}	Back alignment and structure

>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A*	Back alignment and structure

>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus}	Back alignment and structure

>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina}	Back alignment and structure

>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A*	Back alignment and structure

>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440}	Back alignment and structure

>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4	Back alignment and structure

>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A	Back alignment and structure

>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A*	Back alignment and structure

>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus}	Back alignment and structure

>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0	Back alignment and structure

>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A*	Back alignment and structure

>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis}	Back alignment and structure

>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ...	Back alignment and structure

>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A	Back alignment and structure

>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A	Back alignment and structure

>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A*	Back alignment and structure

>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A*	Back alignment and structure

>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A*	Back alignment and structure

>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A*	Back alignment and structure

>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0	Back alignment and structure

>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus}	Back alignment and structure

>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A*	Back alignment and structure

>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A*	Back alignment and structure

>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A	Back alignment and structure

>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1	Back alignment and structure

>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A*	Back alignment and structure

>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A	Back alignment and structure

>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0	Back alignment and structure

>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A*	Back alignment and structure

>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A	Back alignment and structure

>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A	Back alignment and structure

>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A*	Back alignment and structure

>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1	Back alignment and structure

>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii}	Back alignment and structure

>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A*	Back alignment and structure

>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ...	Back alignment and structure

>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1	Back alignment and structure

>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A	Back alignment and structure

>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex}	Back alignment and structure

>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A	Back alignment and structure

>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima}	Back alignment and structure

>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A	Back alignment and structure

>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1	Back alignment and structure

>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1	Back alignment and structure

>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A	Back alignment and structure

>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A	Back alignment and structure

>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp}	Back alignment and structure

>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A	Back alignment and structure

>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1	Back alignment and structure

>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1	Back alignment and structure

>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A	Back alignment and structure

>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis}	Back alignment and structure

>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1	Back alignment and structure

>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9	Back alignment and structure

>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A	Back alignment and structure

>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A	Back alignment and structure

>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1	Back alignment and structure

>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A*	Back alignment and structure

>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A*	Back alignment and structure

>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A*	Back alignment and structure

>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A	Back alignment and structure

>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima}	Back alignment and structure

>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A*	Back alignment and structure

>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A	Back alignment and structure

>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp}	Back alignment and structure

>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A	Back alignment and structure

>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A*	Back alignment and structure

>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii}	Back alignment and structure

>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor}	Back alignment and structure

>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1	Back alignment and structure

>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis}	Back alignment and structure

>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A*	Back alignment and structure

>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae}	Back alignment and structure

>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A	Back alignment and structure

>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A*	Back alignment and structure

>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A*	Back alignment and structure

>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O	Back alignment and structure

>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A	Back alignment and structure

>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A	Back alignment and structure

>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A*	Back alignment and structure

>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4	Back alignment and structure

>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei}	Back alignment and structure

>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ...	Back alignment and structure

>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus}	Back alignment and structure

>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A*	Back alignment and structure

>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str}	Back alignment and structure

>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis}	Back alignment and structure

>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A*	Back alignment and structure

>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri}	Back alignment and structure

>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum}	Back alignment and structure

>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A*	Back alignment and structure

>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2	Back alignment and structure

>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1	Back alignment and structure

>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A*	Back alignment and structure

>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A	Back alignment and structure

>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A*	Back alignment and structure

>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A	Back alignment and structure

>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2	Back alignment and structure

>3s1x_A Probable transaldolase; alpha-beta barrel, conformational selection, domain swapping transferase; HET: I22; 1.65A {Thermoplasma acidophilum} PDB: 3s1u_A* 3s1v_A* 3s0c_A* 3s1w_A*	Back alignment and structure

>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3}	Back alignment and structure

>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A*	Back alignment and structure

>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2	Back alignment and structure

>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1	Back alignment and structure

>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni}	Back alignment and structure

>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A	Back alignment and structure

>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A	Back alignment and structure

>4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A*	Back alignment and structure

>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A	Back alignment and structure

>3r8r_A Transaldolase; pentose phosphate pathway, schiff bases; 1.90A {Bacillus subtilis}	Back alignment and structure

>1vpx_A Protein (transaldolase (EC 2.2.1.2)); TM0295, structural genomics, JOI for structural genomics, JCSG; HET: GOL; 2.40A {Thermotoga maritima} SCOP: c.1.10.1	Back alignment and structure

>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1	Back alignment and structure

>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A*	Back alignment and structure

>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp}	Back alignment and structure

>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A*	Back alignment and structure

>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1	Back alignment and structure

>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0	Back alignment and structure

>1l6w_A Fructose-6-phosphate aldolase 1; alpha-beta barrel, domain swapping, lyase; 1.93A {Escherichia coli} SCOP: c.1.10.1	Back alignment and structure

>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1	Back alignment and structure

>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1	Back alignment and structure

>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1	Back alignment and structure

>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp}	Back alignment and structure

>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2	Back alignment and structure

>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A*	Back alignment and structure

>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1	Back alignment and structure

>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A*	Back alignment and structure

>2i1o_A Nicotinate phosphoribosyltransferase; ZIN ION, zinc finger M structural genomics, PSI, protein structure initiative; 2.40A {Thermoplasma acidophilum} PDB: 1ytd_A* 1yte_A* 1ytk_A	Back alignment and structure

>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1	Back alignment and structure

>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A	Back alignment and structure

>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A	Back alignment and structure

>1wx0_A Transaldolase; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferas; 2.27A {Thermus thermophilus HB8} SCOP: c.1.10.1	Back alignment and structure

>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A*	Back alignment and structure

>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae}	Back alignment and structure

>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3}	Back alignment and structure

>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp}	Back alignment and structure

>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A	Back alignment and structure

>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8}	Back alignment and structure

>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum}	Back alignment and structure

>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus}	Back alignment and structure

>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A*	Back alignment and structure

>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A*	Back alignment and structure

>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A*	Back alignment and structure

>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A	Back alignment and structure

>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4	Back alignment and structure

>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A	Back alignment and structure

>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A	Back alignment and structure

>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum}	Back alignment and structure

>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A	Back alignment and structure

>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str}	Back alignment and structure

>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A*	Back alignment and structure

>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0	Back alignment and structure

>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A*	Back alignment and structure

>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A	Back alignment and structure

>3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A	Back alignment and structure

>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str}	Back alignment and structure

>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1	Back alignment and structure

>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A	Back alignment and structure

>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus}	Back alignment and structure

>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A*	Back alignment and structure

>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0	Back alignment and structure

>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661}	Back alignment and structure

>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae}	Back alignment and structure

>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A	Back alignment and structure

>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A*	Back alignment and structure

>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa}	Back alignment and structure

>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A*	Back alignment and structure

>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A*	Back alignment and structure

>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A	Back alignment and structure

>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A*	Back alignment and structure

>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0	Back alignment and structure

>1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3	Back alignment and structure

>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp}	Back alignment and structure

>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus}	Back alignment and structure

>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0	Back alignment and structure

>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis}	Back alignment and structure

>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A	Back alignment and structure

>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae}	Back alignment and structure

>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis}	Back alignment and structure

>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0	Back alignment and structure

>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A*	Back alignment and structure

>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A	Back alignment and structure

>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa}	Back alignment and structure

>3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri}	Back alignment and structure

>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831}	Back alignment and structure

>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri}	Back alignment and structure

>4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus}	Back alignment and structure

>3kp1_A D-ornithine aminomutase E component; 5 aminomutase (OAM), metal binding protein; HET: PLP B12 5AD; 2.01A {Clostridium sticklandii} PDB: 3kow_A* 3koy_A* 3koz_A* 3kp0_A* 3kox_A*	Back alignment and structure

>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix}	Back alignment and structure

>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A	Back alignment and structure

>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti}	Back alignment and structure

>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A	Back alignment and structure

>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A	Back alignment and structure

>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa}	Back alignment and structure

>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A*	Back alignment and structure

>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A*	Back alignment and structure

>2i14_A Nicotinate-nucleotide pyrophosphorylase; ligand binding, phosphoribosylpyrophosphate, Zn metal ION, structural genomics, PSI; HET: PCP; 2.90A {Pyrococcus furiosus} SCOP: c.1.17.1 d.41.2.1	Back alignment and structure

>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A*	Back alignment and structure

>4aaj_A N-(5'-phosphoribosyl)anthranilate isomerase; alpha/beta-barrel, hyperthermophilic, phosphoribo isomerase; 1.75A {Pyrococcus furiosus}	Back alignment and structure

>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A	Back alignment and structure

>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1	Back alignment and structure

>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A*	Back alignment and structure

>1v5x_A PRA isomerase, phosphoribosylanthranilate isomerase; alpha-beta barrel, TRPF, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.1.2.4	Back alignment and structure

>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0	Back alignment and structure

>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A*	Back alignment and structure

>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor}	Back alignment and structure

>1xrs_B D-lysine 5,6-aminomutase beta subunit; TIM barrel, rossmann domain, PLP, cobalamin, 5'-deoxyad radical, adenosylcobalamin; HET: B12 PLP 5AD; 2.80A {Clostridium sticklandii} SCOP: c.23.6.1 d.230.4.1	Back alignment and structure

>2xij_A Methylmalonyl-COA mutase, mitochondrial; isomerase, organic aciduria, vitamin B12; HET: B12 5AD BTB; 1.95A {Homo sapiens} PDB: 2xiq_A* 3bic_A	Back alignment and structure

>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1	Back alignment and structure

>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7	Back alignment and structure

>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A	Back alignment and structure

>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens}	Back alignment and structure

>3gk0_A PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei}	Back alignment and structure

>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti}	Back alignment and structure

>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A*	Back alignment and structure

>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		447
d1ofda2		809	c.1.4.1 (A:431-1239) Alpha subunit of glutamate sy	1e-140
d1ea0a2		771	c.1.4.1 (A:423-1193) Alpha subunit of glutamate sy	1e-138
d1p0ka_		329	c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomera	5e-35
d1vcfa1		310	c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-i	7e-22
d1kbia1		414	c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal	2e-04

>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Length = 809	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: Alpha subunit of glutamate synthase, central and FMN domains
species: Synechocystis sp. [TaxId: 1143]

 Score =  419 bits (1078), Expect = e-140
 Identities = 195/376 (51%), Positives = 248/376 (65%), Gaps = 8/376 (2%)

Query: 25  FQEAASNNNKNAYDRFRE--SNMESVKYSTLRGQLDFVTHDKPVDISEVEPAAEIVKRFA 82
           ++   + NN  AYD +      ++    + LR  LDF      + + EVE    IVKRF 
Sbjct: 382 YKVGGNGNNGEAYDHYELYRQYLKDRPVTALRDLLDFNADQPAISLEEVESVESIVKRFC 441

Query: 83  TGAMSFGSISIEAHTTLAKAMNKIGAKSNTGEGGENPERYLSSGDENQRSAIKQGKLYPK 142
           TG MS G++S EAH TLA AMN++GAKSN+GEGGE+  RYL+  D +             
Sbjct: 442 TGGMSLGALSREAHETLAIAMNRLGAKSNSGEGGEDVVRYLTLDDVDSEGNSPTLPHLHG 501

Query: 143 TYCFLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVT 202
                ++            +ASGRFGVT  YL     L+IKMAQGAKPGEGG+LPG KV+
Sbjct: 502 LQNGDTANSAIKQ------IASGRFGVTPEYLMSGKQLEIKMAQGAKPGEGGQLPGKKVS 555

Query: 203 KDIASTRHSVPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARISVKLVSEVGVGVVA 262
           + IA  R S PGV LISPPPHHDIYSIEDLA+LIYDL   NP A++SVKLV+E+G+G +A
Sbjct: 556 EYIAMLRRSKPGVTLISPPPHHDIYSIEDLAQLIYDLHQINPEAQVSVKLVAEIGIGTIA 615

Query: 263 SGVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLALNNLRSRVVLQAD 322
           +GVAK  A+ I ISGHDGGTGAS  + IK+AG PWELGV E H+VL  N LR RV+L+AD
Sbjct: 616 AGVAKANADIIQISGHDGGTGASPLSSIKHAGSPWELGVTEVHRVLMENQLRDRVLLRAD 675

Query: 323 GQIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIATQDPELRKKFAG 382
           G ++TG+DVV+AAL+GA+E G  +  +I  GC M R CH N CPVG+ATQ   LR++F G
Sbjct: 676 GGLKTGWDVVMAALMGAEEYGFGSIAMIAEGCIMARVCHTNNCPVGVATQQERLRQRFKG 735

Query: 383 KPEHVINYLFMLAEEV 398
            P  V+N+ + +AEEV
Sbjct: 736 VPGQVVNFFYFIAEEV 751

PyMOL of d1ofda2

>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Length = 771	Back information, alignment and structure

>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Length = 329	Back information, alignment and structure

>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Length = 310	Back information, alignment and structure

>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 414	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		447
d1ofda2		809	Alpha subunit of glutamate synthase, central and F	100.0
d1ea0a2		771	Alpha subunit of glutamate synthase, central and F	100.0
d1tb3a1		349	Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI	100.0
d1p0ka_		329	Isopentenyl-diphosphate delta-isomerase {Bacillus	100.0
d1goxa_		359	Glycolate oxidase {Spinach (Spinacia oleracea) [Ta	100.0
d1kbia1		414	Flavocytochrome b2, C-terminal domain {Baker's yea	100.0
d1p4ca_		353	Membrane-associated (S)-mandelate dehydrogenase {P	100.0
d1vcfa1		310	Isopentenyl-diphosphate delta-isomerase {Thermus t	100.0
d1vrda1		330	Inosine monophosphate dehydrogenase (IMPDH) {Therm	99.77
d1jr1a1		378	Inosine monophosphate dehydrogenase (IMPDH) {Chine	99.74
d1zfja1		365	Inosine monophosphate dehydrogenase (IMPDH) {Strep	99.7
d1eepa_		388	Inosine monophosphate dehydrogenase (IMPDH) {Lyme	99.65
d2cu0a1		368	Inosine monophosphate dehydrogenase (IMPDH) {Pyroc	99.59
d1pvna1		362	Inosine monophosphate dehydrogenase (IMPDH) {Tritr	99.49
d1juba_		311	Dihydroorotate dehydrogenase {Lactococcus lactis,	99.17
d1gtea2		312	Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su	99.11
d1yxya1		230	Putative N-acetylmannosamine-6-phosphate 2-epimera	99.06
d1y0ea_		222	Putative N-acetylmannosamine-6-phosphate 2-epimera	99.02
d1ep3a_		311	Dihydroorotate dehydrogenase {Lactococcus lactis,	98.98
d1tv5a1		409	Dihydroorotate dehydrogenase {Plasmodium falciparu	98.91
d1d3ga_		367	Dihydroorotate dehydrogenase {Human (Homo sapiens)	98.8
d2b4ga1		312	Dihydroorotate dehydrogenase {Trypanosoma brucei [	98.58
d1f76a_		336	Dihydroorotate dehydrogenase {Escherichia coli [Ta	98.3
d1z41a1		337	NADPH dehydrogenase NamA {Bacillus subtilis [TaxId	97.93
d1djqa1		340	Trimethylamine dehydrogenase, N-terminal domain {M	97.9
d1ps9a1		330	2,4-dienoyl-CoA reductase, N-terminal domain {Esch	97.88
d1vhna_		305	Putative flavin oxidoreducatase TM0096 {Thermotoga	97.87
d1wv2a_		243	Thiazole biosynthesis protein ThiG {Pseudomonas ae	97.82
d1mzha_		225	Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli	97.68
d1ub3a_		211	Deoxyribose-phosphate aldolase DeoC {Thermus therm	97.62
d1xm3a_		251	Thiazole biosynthesis protein ThiG {Bacillus subti	97.53
d1o0ya_		251	Deoxyribose-phosphate aldolase DeoC {Thermotoga ma	97.47
d1qopa_		267	Trp synthase alpha-subunit {Salmonella typhimurium	97.35
d1p1xa_		250	Deoxyribose-phosphate aldolase DeoC {Escherichia c	97.25
d1vyra_		363	Pentaerythritol tetranirate reductase {Enterobacte	97.17
d1ofda2		809	Alpha subunit of glutamate synthase, central and F	96.99
d1n7ka_		234	Deoxyribose-phosphate aldolase DeoC {Archaeon Aero	96.99
d1hg3a_		224	Triosephosphate isomerase {Archaeon Pyrococcus woe	96.98
d1ea0a2		771	Alpha subunit of glutamate synthase, central and F	96.93
d1w0ma_		226	Triosephosphate isomerase {Thermoproteus tenax [Ta	96.9
d1a53a_		247	Indole-3-glycerophosphate synthase, IPGS {Archaeon	96.81
d1vcva1		226	Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro	96.5
d1q45a_		380	12-oxophytodienoate reductase (OPR, OYE homolog) {	96.46
d1znna1		254	Pyridoxal biosynthesis lyase PdxS {Bacillus stearo	96.41
d1geqa_		248	Trp synthase alpha-subunit {Archaeon Pyrococcus fu	96.26
d1rd5a_		261	Trp synthase alpha-subunit {Maize (Zea mays) [TaxI	96.25
d1qpoa1		169	Quinolinic acid phosphoribosyltransferase (Nicotin	96.24
d1gwja_		374	Morphinone reductase {Pseudomonas putida [TaxId: 3	96.18
d1xi3a_		206	Thiamin phosphate synthase {Archaeon (Pyrococcus f	96.16
d2a4aa1		256	Fructose-1,6-bisphosphate aldolase {Plasmodium yoe	96.12
d1q6oa_		213	3-keto-L-gulonate 6-phosphate decarboxylase {Esche	95.92
d1qapa1		167	Quinolinic acid phosphoribosyltransferase (Nicotin	95.86
d1o4ua1		170	Quinolinic acid phosphoribosyltransferase (Nicotin	95.49
d1ka9f_		251	Cyclase subunit (or domain) of imidazoleglycerolph	95.32
d1h5ya_		252	Cyclase subunit (or domain) of imidazoleglycerolph	95.15
d1oyaa_		399	Old yellow enzyme (OYE) {Lager yeast (Saccharomyce	95.14
d1zfja1		365	Inosine monophosphate dehydrogenase (IMPDH) {Strep	94.97
d1icpa_		364	12-oxophytodienoate reductase (OPR, OYE homolog) {	94.63
d1thfd_		253	Cyclase subunit (or domain) of imidazoleglycerolph	94.63
d1l6wa_		220	Decameric fructose-6-phosphate aldolase/transaldol	94.61
d1thfd_		253	Cyclase subunit (or domain) of imidazoleglycerolph	94.46
d1vc4a_		254	Indole-3-glycerophosphate synthase, IPGS {Thermus	94.43
d1h5ya_		252	Cyclase subunit (or domain) of imidazoleglycerolph	94.34
d1qo2a_		241	Phosphoribosylformimino-5-aminoimidazole carboxami	94.26
d1ujpa_		271	Trp synthase alpha-subunit {Thermus thermophilus [	94.16
d1vzwa1		239	Phosphoribosylformimino-5-aminoimidazole carboxami	94.03
d1jvna1		323	Cyclase subunit (or domain) of imidazoleglycerolph	94.0
d2tpsa_		226	Thiamin phosphate synthase {Bacillus subtilis [Tax	93.91
d1ka9f_		251	Cyclase subunit (or domain) of imidazoleglycerolph	93.8
d1vzwa1		239	Phosphoribosylformimino-5-aminoimidazole carboxami	93.75
d1wx0a1		211	Decameric fructose-6-phosphate aldolase/transaldol	93.71
d1tqxa_		221	D-ribulose-5-phosphate 3-epimerase {Plasmodium fal	93.48
d1piia2		254	Indole-3-glycerophosphate synthase, IPGS {Escheric	93.18
d1wa3a1		202	KDPG aldolase {Thermotoga maritima [TaxId: 2336]}	93.18
d1vpxa_		218	Decameric fructose-6-phosphate aldolase/transaldol	92.91
d1xrsb1		160	D-lysine 5,6-aminomutase beta subunit KamE, C-term	92.59
d1i4na_		251	Indole-3-glycerophosphate synthase, IPGS {Thermoto	92.38
d1jvna1		323	Cyclase subunit (or domain) of imidazoleglycerolph	91.72
d2flia1		217	D-ribulose-5-phosphate 3-epimerase {Streptococcus	91.55
d1vrda1		330	Inosine monophosphate dehydrogenase (IMPDH) {Therm	91.47
d1pvna1		362	Inosine monophosphate dehydrogenase (IMPDH) {Tritr	91.4
d1eepa_		388	Inosine monophosphate dehydrogenase (IMPDH) {Lyme	91.26
d1jr1a1		378	Inosine monophosphate dehydrogenase (IMPDH) {Chine	91.22
d7reqa2		168	Methylmalonyl-CoA mutase alpha subunit, C-terminal	91.18
d1vhca_		212	Hypothetical protein HI0047 {Haemophilus influenza	90.53
d1mxsa_		216	KDPG aldolase {Pseudomonas putida [TaxId: 303]}	90.29
d1h1ya_		220	D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa	90.19
d1wbha1		213	KDPG aldolase {Escherichia coli [TaxId: 562]}	90.1
d1xkya1		292	Dihydrodipicolinate synthase {Bacillus anthracis [	89.67
d1qo2a_		241	Phosphoribosylformimino-5-aminoimidazole carboxami	89.11
d2f6ua1		231	(S)-3-O-geranylgeranylglyceryl phosphate synthase	89.09
d1xxxa1		296	Dihydrodipicolinate synthase {Mycobacterium tuberc	88.98
d2a6na1		292	Dihydrodipicolinate synthase {Escherichia coli [Ta	88.91
d2p10a1		197	Uncharacterized protein Mll9387 {Mesorhizobium lot	88.9
d1viza_		229	PcrB protein homolog YerE {Bacillus subtilis [TaxI	88.22
d2cu0a1		368	Inosine monophosphate dehydrogenase (IMPDH) {Pyroc	87.84
d1ccwa_		137	Glutamate mutase, small subunit {Clostridium cochl	87.0
d1gtea2		312	Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su	86.78
d1o5ka_		295	Dihydrodipicolinate synthase {Thermotoga maritima	86.76
d1rpxa_		230	D-ribulose-5-phosphate 3-epimerase {Potato (Solanu	86.72
d1wa3a1		202	KDPG aldolase {Thermotoga maritima [TaxId: 2336]}	82.31
d1p0ka_		329	Isopentenyl-diphosphate delta-isomerase {Bacillus	80.75

>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: Alpha subunit of glutamate synthase, central and FMN domains
species: Synechocystis sp. [TaxId: 1143]

Probab=100.00  E-value=1.5e-102  Score=847.30  Aligned_cols=409  Identities=49%  Similarity=0.801  Sum_probs=384.7

Q ss_pred             CCCccceeeecCCcccccchhh-HHHHHHHhc----------CCHHHHHHHHHHhhhccCccccccccccccCCCCCCCC
Q psy10999          1 INKHYYYYFYKSITGLISKPFS-TDFQEAASN----------NNKNAYDRFRESNMESVKYSTLRGQLDFVTHDKPVDIS   69 (447)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~   69 (447)
                      |+.+|+|+||++||+|.|||++ +.||+|+|+          ++|+.|++|++.+++ .++++||+||+|++++++||++
T Consensus       350 L~~gG~y~~R~~GE~H~~nP~~i~~LQ~avr~~~~~~~~n~~~~Y~~y~~~~~~~~~-~~~~~lR~Ll~~k~~~~pIpld  428 (809)
T d1ofda2         350 LENFGFVNYRPGGEYHMNSPEMSKSLHKAVAAYKVGGNGNNGEAYDHYELYRQYLKD-RPVTALRDLLDFNADQPAISLE  428 (809)
T ss_dssp             CCCCSSSSCCTTSSCCSCCHHHHHHHHHHHHHC------------CHHHHHHHHHHT-CCSCSGGGGEEECCSSCCCCGG
T ss_pred             cccccceeeeccccccCCCHHHHHHHHHHHHhhhhhccccCHHHHHHHHHHHHHHhc-CChhhHHHHhhhhccCCCCChh
Confidence            5789999999999999999999 999999974          469999999999876 4799999999999988999999


Q ss_pred             CCccccccccceeecCCCcccCcHHHHHHHHHHHHHhCCceeecCCCCChhhhhcc-------------------CCCCC
Q psy10999         70 EVEPAAEIVKRFATGAMSFGSISIEAHTTLAKAMNKIGAKSNTGEGGENPERYLSS-------------------GDENQ  130 (447)
Q Consensus        70 ~v~~~~~i~~Pf~iaaMs~G~ls~ea~~aLA~AA~~~G~~~~sGeg~~~~e~~~~~-------------------~~~~~  130 (447)
                      ||||+.+|.+||.|++||||++|+++|++||+||+++|+.+||||||++|+++...                   +++..
T Consensus       429 eVEp~~~I~k~f~~~aMS~GslS~~a~~ala~aa~~~G~~~ntGEGG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~  508 (809)
T d1ofda2         429 EVESVESIVKRFCTGGMSLGALSREAHETLAIAMNRLGAKSNSGEGGEDVVRYLTLDDVDSEGNSPTLPHLHGLQNGDTA  508 (809)
T ss_dssp             GSCCHHHHHTTEECCCBCTTTSCHHHHHHHHHHHHHHTCBCEECTTCCCGGGGSCCCCCCTTSCCTTSTTCCSCCTTCCC
T ss_pred             hcchhhhhhhhhcccccccccccHHHHHHHHHHHHHhCceecCCCCCCCceeeeccCccccccCcccccccccccCCCCC
Confidence            99999999999999999999999999999999999999999999999999987421                   12233


Q ss_pred             CCeEEeCCCCccccccccceeeccccccccccccCCCCCChHhhccccccccccccccCCCCCCCCCCCcccHHHHhhcC
Q psy10999        131 RSAIKQGKLYPKTYCFLSSLFTDLFPVYGLPVASGRFGVTSSYLAHADDLQIKMAQGAKPGEGGELPGYKVTKDIASTRH  210 (447)
Q Consensus       131 ~~~i~Q~~ly~~~~~~~~lv~t~d~p~~~~rv~s~rfGv~~~~l~~a~~ieik~~QgAkPg~gg~l~~~kv~~~ia~~r~  210 (447)
                      .+.++|                         ++++||||++++|.++++||||++||||||+||+||+.||+++||++|+
T Consensus       509 ~s~i~q-------------------------~asgrfGv~~~~l~~~~~ieIK~~QGAKPG~GG~Lpg~KVt~~IA~~R~  563 (809)
T d1ofda2         509 NSAIKQ-------------------------IASGRFGVTPEYLMSGKQLEIKMAQGAKPGEGGQLPGKKVSEYIAMLRR  563 (809)
T ss_dssp             CCSEEE-------------------------ECTTCTTCCHHHHHHCSEEEEECCCTTSTTSCCEECGGGCCHHHHHHHT
T ss_pred             cchhHh-------------------------hhhcccCCChhhhcccceEEEEEecccccccccccchhhcCHHHHhhcC
Confidence            445666                         9999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccccCCCCCCCCCCHHHHHHHHHHHHHhCCCCceEEEEeeeccHHHHHHHHHHCCCcEEEEecCCCCCCCcccccc
Q psy10999        211 SVPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGI  290 (447)
Q Consensus       211 ~~~g~~lisp~~~~~~~s~edl~~~I~~Lr~~~p~~pI~VKlv~~~Gi~~~A~~a~~aGaD~I~VsG~~GGtg~a~~~~~  290 (447)
                      ++||++++||++||||||+|||.|+|++||+.+|++||+||++++.|+++++..++++|||+|+|||++||||++|.+++
T Consensus       564 ~~~G~~liSP~~h~diysiedL~q~I~~Lr~~~~~~pv~vKl~~~~g~~~ia~~vaka~aD~I~IdG~eGGTGAap~~~~  643 (809)
T d1ofda2         564 SKPGVTLISPPPHHDIYSIEDLAQLIYDLHQINPEAQVSVKLVAEIGIGTIAAGVAKANADIIQISGHDGGTGASPLSSI  643 (809)
T ss_dssp             SCTTCCEECCSSCTTCSSHHHHHHHHHHHHHHCTTSEEEEEEECSTTHHHHHHHHHHTTCSEEEEECTTCCCSSEEHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHhCCCCceEEEEeeecChHHHHHHHhhcCCCEEEEeCCCCccccccHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCChHHHHHHHHHHHHhcCCCCceEEEEcCCCCChHHHHHHHHcCCCeeccChHHHHHhcccchhcccCCCCccccc
Q psy10999        291 KNAGLPWELGVAETHQVLALNNLRSRVVLQADGQIRTGFDVVVAALLGADEIGLSTAPLITMGCTMMRKCHLNTCPVGIA  370 (447)
Q Consensus       291 ~~~G~p~~~~L~ev~~~l~~~glr~~v~viadGGIrtg~Dv~kAlaLGAd~V~iGt~~L~algc~~~~~c~~~~cP~gia  370 (447)
                      ++.|+||+.+|++++++|.++|+|++|+||+|||++||.|++||++||||+|++||.+|+|+||+|||+||+|+|||||+
T Consensus       644 ~~~GlP~~~gl~~a~~~L~~~glR~~V~Lia~Ggl~t~~Dv~ka~aLGAD~v~~gt~~l~alGCi~~r~Ch~n~CP~GIa  723 (809)
T d1ofda2         644 KHAGSPWELGVTEVHRVLMENQLRDRVLLRADGGLKTGWDVVMAALMGAEEYGFGSIAMIAEGCIMARVCHTNNCPVGVA  723 (809)
T ss_dssp             HHBCCCHHHHHHHHHHHHHHTTCGGGCEEEEESSCCSHHHHHHHHHTTCSEEECSHHHHHHTTCCCCCCGGGTCCTTSSS
T ss_pred             hcCCccHHHHHHHHHHHHHHcCCCCceEEEEeCCCCCHHHHHHHHHhCCCchhHhHHHHHHHHCHHhHhhCCCCCCCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCHHHHhhcCCcHHHHHHHHHHHHHHHHHHHhhhCCCCCCcccc--ccccccccccccccccccccccc
Q psy10999        371 TQDPELRKKFAGKPEHVINYLFMLAEEVSRDYRAESPGFDFPLVW--LGDFKQEGDQLSLVWGTLTMKVT  438 (447)
Q Consensus       371 t~~~~l~~~~~~g~~~V~~~l~~l~~Elr~~M~l~~~G~~s~~~l--~~~~~~~~~~~~~~~~~~~~~~~  438 (447)
                      ||||+|+++|++.+++|.||+..+.+|++++|+.  ||.+|+.++  +.|++....... +||+..+|++
T Consensus       724 Tqd~~l~~~~~~~~~~v~n~~~~~~~e~~~~~a~--~G~~s~~elvGr~dll~~~~~~~-~~~~~~l~~~  790 (809)
T d1ofda2         724 TQQERLRQRFKGVPGQVVNFFYFIAEEVRSLLAH--LGYRSLDDIIGRTDLLKVRSDVQ-LSKTQNLTLD  790 (809)
T ss_dssp             CCCHHHHTTCCCCHHHHHHHHHHHHHHHHHHHHH--HTCSCGGGTTTCGGGEEECSSCC-CSSSSCCCCH
T ss_pred             CCCHHHHhhCcCcHHHHHHHHHHHHHHHHHHHHH--HcCCCHHHhcChHhhhhhccccc-chhhcCCCHH
Confidence            9999999999999999999999999999999999  999999986  678887755443 8999999886

PyMOL of d1ofda2

>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]}	Back information, alignment and structure

>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]}	Back information, alignment and structure

>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}	Back information, alignment and structure

>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]}	Back information, alignment and structure

>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]}	Back information, alignment and structure

>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]}	Back information, alignment and structure

>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}	Back information, alignment and structure

>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]}	Back information, alignment and structure

>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]}	Back information, alignment and structure

>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]}	Back information, alignment and structure

>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]}	Back information, alignment and structure

>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]}	Back information, alignment and structure

>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]}	Back information, alignment and structure

>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]}	Back information, alignment and structure

>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]}	Back information, alignment and structure

>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]}	Back information, alignment and structure

>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1l6wa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]}	Back information, alignment and structure

>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1wx0a1 c.1.10.1 (A:1-211) Decameric fructose-6-phosphate aldolase/transaldolase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1vpxa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1xrsb1 c.23.6.1 (B:102-261) D-lysine 5,6-aminomutase beta subunit KamE, C-terminal domain {Clostridium sticklandii [TaxId: 1511]}	Back information, alignment and structure

>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]}	Back information, alignment and structure

>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]}	Back information, alignment and structure

>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}	Back information, alignment and structure

>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}	Back information, alignment and structure

>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]}	Back information, alignment and structure

>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]}	Back information, alignment and structure

>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]}	Back information, alignment and structure

>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]}	Back information, alignment and structure

>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure