Diaphorina citri psyllid: psy11001


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGSGPSGLGAAHQLNKEAGTELIK
ccccccccccHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccccccEEEEEcccHHHHHHHHHHHHccccEEcc
FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGSGPSGLGAAHQLNKEAGTELIK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGSGPSGLGAAHQLNKEAGTELIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamate synthase 1 [NADH], chloroplastic Involved in glutamate biosynthesis. Required for non-photorespiratory ammonium assimilation. Probably involved in primary ammonium assimilation in roots.confidentQ9LV03
Glutamate synthase [NADPH] small chain confidentO34399
Glutamate synthase 1 [NADH], chloroplastic Involved in glutamate biosynthesis and plays a major role in the primary ammonium ions assimilation in seedling roots. May be involved in the reutilization of glutamine in developing organs. Plays a role in the development of tillers.confidentQ0JKD0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0048589 [BP]developmental growthprobableGO:0044767, GO:0032502, GO:0008150, GO:0040007, GO:0044699
GO:0042128 [BP]nitrate assimilationprobableGO:0042126, GO:0044710, GO:0071941, GO:0006082, GO:0009987, GO:0044237, GO:2001057, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016040 [MF]glutamate synthase (NADH) activityprobableGO:0015930, GO:0016638, GO:0016639, GO:0003824, GO:0003674, GO:0045181, GO:0016491
GO:0051536 [MF]iron-sulfur cluster bindingprobableGO:0003674, GO:0051540, GO:0005488
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0019676 [BP]ammonia assimilation cycleprobableGO:0043648, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:0044238, GO:0044237, GO:0006520, GO:0006541, GO:0019752, GO:0071704, GO:0006536, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0009064, GO:0043436, GO:1901605
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005506 [MF]iron ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0060359 [BP]response to ammonium ionprobableGO:0042221, GO:1901698, GO:0008150, GO:0050896
GO:0006537 [BP]glutamate biosynthetic processprobableGO:0044238, GO:0044283, GO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:0009064, GO:1901576, GO:0044710, GO:0044711, GO:0043650, GO:0006520, GO:0071704, GO:1901605, GO:1901607, GO:0008652, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0043648, GO:1901564, GO:1901566, GO:0006082, GO:0046394, GO:0016053, GO:0044237, GO:0006536, GO:0009084
GO:0050660 [MF]flavin adenine dinucleotide bindingprobableGO:0043168, GO:0050662, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265
GO:0010181 [MF]FMN bindingprobableGO:0043168, GO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:1901265, GO:0003674, GO:0043167, GO:1901363, GO:0032553, GO:0005488
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VDC, chain G
Confidence level:very confident
Coverage over the Query: 1-80
View the alignment between query and template
View the model in PyMOL