Psyllid ID: psy11001


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGSGPSGLGAAHQLNKEAGTELIK
cccccccccHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccccccEEEEEccHHHHHHHHHHHHHccccEEcc
cccccccccccccEEEccccccccHHHHHHHHHHHHHHcccEcccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEc
ftgrvcpapcegacvlginepavtiKNIECAIIDHafeqgwikpeiptlrtgkkvaivgsgpsglgaAHQLNKEAGTELIK
ftgrvcpapcegACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGSGpsglgaahqlnkeagtelik
FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGSGPSGLGAAHQLNKEAGTELIK
****VCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVG**********************
FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGSGPSGLGAAHQLNKEAGTELIK
FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGSGPSGLGAAHQLN*********
**GRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGSGPSGLGAAHQLNKEAGTELIK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGSGPSGLGAAHQLNKEAGTELIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query81 2.2.26 [Sep-21-2011]
Q03460 2194 Glutamate synthase [NADH] N/A N/A 0.901 0.033 0.780 3e-28
Q9LV03 2208 Glutamate synthase 1 [NAD yes N/A 0.901 0.033 0.753 2e-27
Q0JKD0 2167 Glutamate synthase 1 [NAD yes N/A 0.901 0.033 0.739 1e-26
O34399 493 Glutamate synthase [NADPH yes N/A 0.901 0.148 0.726 3e-26
Q0DG35 2188 Glutamate synthase 2 [NAD no N/A 0.901 0.033 0.726 4e-26
Q9C102 2111 Putative glutamate syntha yes N/A 0.901 0.034 0.684 2e-24
Q12680 2145 Glutamate synthase [NADH] yes N/A 0.950 0.035 0.610 1e-22
P96219 488 Glutamate synthase [NADPH yes N/A 0.950 0.157 0.623 1e-22
P09832 472 Glutamate synthase [NADPH N/A N/A 0.864 0.148 0.527 1e-11
P37127 659 Protein AegA OS=Escherich N/A N/A 0.888 0.109 0.460 1e-09
>sp|Q03460|GLSN_MEDSA Glutamate synthase [NADH], amyloplastic OS=Medicago sativa PE=1 SV=1 Back     alignment and function desciption
 Score =  123 bits (309), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 62/73 (84%)

Query: 1    FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGS 60
            FTGRVCPAPCEG+CVLGI E  V+IKNIECAIID AFE+GW+ P  P  RTGK+VAIVGS
Sbjct: 1773 FTGRVCPAPCEGSCVLGIIENPVSIKNIECAIIDKAFEEGWMIPRPPVKRTGKRVAIVGS 1832

Query: 61   GPSGLGAAHQLNK 73
            GPSGL AA QLNK
Sbjct: 1833 GPSGLAAADQLNK 1845





Medicago sativa (taxid: 3879)
EC: 1EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 4
>sp|Q9LV03|GLUT1_ARATH Glutamate synthase 1 [NADH], chloroplastic OS=Arabidopsis thaliana GN=GLT1 PE=1 SV=2 Back     alignment and function description
>sp|Q0JKD0|GLT1_ORYSJ Glutamate synthase 1 [NADH], chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0681900 PE=2 SV=1 Back     alignment and function description
>sp|O34399|GLTB_BACSU Glutamate synthase [NADPH] small chain OS=Bacillus subtilis (strain 168) GN=gltB PE=2 SV=2 Back     alignment and function description
>sp|Q0DG35|GLT2_ORYSJ Glutamate synthase 2 [NADH], chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0555600 PE=2 SV=2 Back     alignment and function description
>sp|Q9C102|GLT1_SCHPO Putative glutamate synthase [NADPH] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glt1 PE=2 SV=1 Back     alignment and function description
>sp|Q12680|GLT1_YEAST Glutamate synthase [NADH] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLT1 PE=1 SV=2 Back     alignment and function description
>sp|P96219|GLTD_MYCTU Glutamate synthase [NADPH] small chain OS=Mycobacterium tuberculosis GN=gltD PE=3 SV=1 Back     alignment and function description
>sp|P09832|GLTD_ECOLI Glutamate synthase [NADPH] small chain OS=Escherichia coli (strain K12) GN=gltD PE=1 SV=3 Back     alignment and function description
>sp|P37127|AEGA_ECOLI Protein AegA OS=Escherichia coli (strain K12) GN=aegA PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
328721168 2080 PREDICTED: putative glutamate synthase [ 0.901 0.035 0.904 4e-34
195590926 2252 GD12441 [Drosophila simulans] gi|1941972 0.901 0.032 0.876 3e-33
350405948 2065 PREDICTED: putative glutamate synthase [ 0.901 0.035 0.863 8e-33
350405946 2065 PREDICTED: putative glutamate synthase [ 0.901 0.035 0.863 8e-33
340711712 2066 PREDICTED: putative glutamate synthase [ 0.901 0.035 0.863 8e-33
111120011 2084 glutamate synthase [Aedes aegypti] 0.901 0.035 0.863 3e-32
307210154 2138 Putative glutamate synthase [NADPH] [Har 0.901 0.034 0.849 3e-32
157107014 2084 glutamate synthase [Aedes aegypti] gi|10 0.901 0.035 0.863 3e-32
195495005 2116 GE22188 [Drosophila yakuba] gi|194181184 0.901 0.034 0.876 4e-32
194872333 2114 GG15849 [Drosophila erecta] gi|190654793 0.901 0.034 0.876 4e-32
>gi|328721168|ref|XP_001948786.2| PREDICTED: putative glutamate synthase [NADPH]-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 66/73 (90%), Positives = 68/73 (93%)

Query: 1    FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGS 60
            FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPE P +R+GK VAIVGS
Sbjct: 1676 FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEPPKIRSGKTVAIVGS 1735

Query: 61   GPSGLGAAHQLNK 73
            GPSGL  AHQLNK
Sbjct: 1736 GPSGLATAHQLNK 1748




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi|195590926|ref|XP_002085195.1| GD12441 [Drosophila simulans] gi|194197204|gb|EDX10780.1| GD12441 [Drosophila simulans] Back     alignment and taxonomy information
>gi|350405948|ref|XP_003487604.1| PREDICTED: putative glutamate synthase [NADPH]-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350405946|ref|XP_003487603.1| PREDICTED: putative glutamate synthase [NADPH]-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340711712|ref|XP_003394415.1| PREDICTED: putative glutamate synthase [NADPH]-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|111120011|gb|AAV31916.2| glutamate synthase [Aedes aegypti] Back     alignment and taxonomy information
>gi|307210154|gb|EFN86827.1| Putative glutamate synthase [NADPH] [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|157107014|ref|XP_001649585.1| glutamate synthase [Aedes aegypti] gi|108868750|gb|EAT32975.1| AAEL014768-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195495005|ref|XP_002095083.1| GE22188 [Drosophila yakuba] gi|194181184|gb|EDW94795.1| GE22188 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194872333|ref|XP_001973010.1| GG15849 [Drosophila erecta] gi|190654793|gb|EDV52036.1| GG15849 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
FB|FBgn0036663 2114 CG9674 [Drosophila melanogaste 0.925 0.035 0.868 1.1e-30
CGD|CAL0000516 2126 GLT1 [Candida albicans (taxid: 0.925 0.035 0.75 6.8e-26
WB|WBGene00012326 2175 W07E11.1 [Caenorhabditis elega 0.987 0.036 0.712 1.5e-25
TAIR|locus:2178461 2208 GLT1 "NADH-dependent glutamate 0.901 0.033 0.753 3.6e-24
ASPGD|ASPL0000027159 2126 gltA [Emericella nidulans (tax 0.901 0.034 0.739 4.4e-24
UNIPROTKB|Q0JKD0 2167 LOC_Os01g48960 "Glutamate synt 0.901 0.033 0.739 9.3e-24
TIGR_CMR|CPS_0762 496 CPS_0762 "glutamate synthase, 0.925 0.151 0.684 9.1e-23
UNIPROTKB|P96219 488 gltD "Glutamate synthase [NADP 0.950 0.157 0.623 1.1e-21
POMBASE|SPAPB1E7.07 2111 glt1 "glutamate synthase Glt1 0.975 0.037 0.65 1.2e-21
UNIPROTKB|Q9KPJ3 489 VC_2374 "Glutamate synthase, s 0.888 0.147 0.652 1.4e-21
FB|FBgn0036663 CG9674 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 354 (129.7 bits), Expect = 1.1e-30, P = 1.1e-30
 Identities = 66/76 (86%), Positives = 72/76 (94%)

Query:     1 FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGS 60
             FTGRVCPAPCEG+CVLGI+EPAVTIKNIECAIIDHAFEQGWIKPEIP +RTGK+VAIVGS
Sbjct:  1715 FTGRVCPAPCEGSCVLGISEPAVTIKNIECAIIDHAFEQGWIKPEIPEVRTGKRVAIVGS 1774

Query:    61 GPSGLGAAHQLNKEAG 76
             GPSGL A+ QLN+ AG
Sbjct:  1775 GPSGLAASQQLNR-AG 1789




GO:0004355 "glutamate synthase (NADPH) activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0016040 "glutamate synthase (NADH) activity" evidence=IEA
GO:0010181 "FMN binding" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0006537 "glutamate biosynthetic process" evidence=IEA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
CGD|CAL0000516 GLT1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
WB|WBGene00012326 W07E11.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2178461 GLT1 "NADH-dependent glutamate synthase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000027159 gltA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q0JKD0 LOC_Os01g48960 "Glutamate synthase 1 [NADH], chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0762 CPS_0762 "glutamate synthase, NADH/NADPH, small subunit" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P96219 gltD "Glutamate synthase [NADPH] small chain" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
POMBASE|SPAPB1E7.07 glt1 "glutamate synthase Glt1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KPJ3 VC_2374 "Glutamate synthase, small subunit" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q12680GLT1_YEAST1, ., 4, ., 1, ., 1, 40.61030.95060.0358yesN/A
Q9LV03GLUT1_ARATH1, ., 4, ., 1, ., 1, 40.75340.90120.0330yesN/A
O34399GLTB_BACSU1, ., 4, ., 1, ., 1, 30.72600.90120.1480yesN/A
Q0JKD0GLT1_ORYSJ1, ., 4, ., 1, ., 1, 40.73970.90120.0336yesN/A
Q9C102GLT1_SCHPO1, ., 4, ., 1, ., 1, 30.68490.90120.0345yesN/A
P96219GLTD_MYCTU1, ., 4, ., 1, ., 1, 30.62330.95060.1577yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
PRK12810 471 PRK12810, gltD, glutamate synthase subunit beta; R 1e-48
TIGR01317 485 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH 4e-40
COG0493 457 COG0493, GltD, NADPH-dependent glutamate synthase 4e-30
PRK11749 457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 2e-24
PRK12771 564 PRK12771, PRK12771, putative glutamate synthase (N 4e-21
TIGR01318 467 TIGR01318, gltD_gamma_fam, glutamate synthase smal 4e-19
PRK12769 654 PRK12769, PRK12769, putative oxidoreductase Fe-S b 7e-17
PRK12831 464 PRK12831, PRK12831, putative oxidoreductase; Provi 2e-15
PRK12814 652 PRK12814, PRK12814, putative NADPH-dependent gluta 4e-13
PRK12778 752 PRK12778, PRK12778, putative bifunctional 2-polypr 5e-13
PRK12809 639 PRK12809, PRK12809, putative oxidoreductase Fe-S b 2e-11
PRK13984 604 PRK13984, PRK13984, putative oxidoreductase; Provi 4e-11
TIGR01316 449 TIGR01316, gltA, glutamate synthase (NADPH), homot 1e-10
PRK09853 1019 PRK09853, PRK09853, putative selenate reductase su 7e-08
PRK12775 1006 PRK12775, PRK12775, putative trifunctional 2-polyp 6e-07
TIGR03315 1012 TIGR03315, Se_ygfK, putative selenate reductase, Y 1e-05
PRK12770 352 PRK12770, PRK12770, putative glutamate synthase su 3e-05
COG1232 444 COG1232, HemY, Protoporphyrinogen oxidase [Coenzym 5e-04
PRK07233 434 PRK07233, PRK07233, hypothetical protein; Provisio 6e-04
COG1252 405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 0.001
PRK12779 944 PRK12779, PRK12779, putative bifunctional glutamat 0.001
COG2072 443 COG2072, TrkA, Predicted flavoprotein involved in 0.001
PRK04176 257 PRK04176, PRK04176, ribulose-1,5-biphosphate synth 0.002
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
 Score =  159 bits (404), Expect = 1e-48
 Identities = 53/73 (72%), Positives = 59/73 (80%)

Query: 1   FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGS 60
           FTGRVCPAPCEGAC L IN   VTIKNIE  IID AFE+GW+KP+ P  RTGKKVA+VGS
Sbjct: 92  FTGRVCPAPCEGACTLNINFGPVTIKNIERYIIDKAFEEGWVKPDPPVKRTGKKVAVVGS 151

Query: 61  GPSGLGAAHQLNK 73
           GP+GL AA QL +
Sbjct: 152 GPAGLAAADQLAR 164


Length = 471

>gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|130385 TIGR01318, gltD_gamma_fam, glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|183762 PRK12809, PRK12809, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|183738 PRK12775, PRK12775, putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183740 PRK12779, PRK12779, putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 81
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 99.87
PRK12831 464 putative oxidoreductase; Provisional 99.87
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 99.86
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 99.85
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 99.85
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 99.85
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 99.84
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.84
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.84
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 99.83
PRK12814 652 putative NADPH-dependent glutamate synthase small 99.82
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.81
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.81
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 99.8
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 99.79
PRK11749 457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.79
KOG0399|consensus 2142 99.79
PRK13984 604 putative oxidoreductase; Provisional 99.77
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain 99.75
PF14691111 Fer4_20: Dihydroprymidine dehydrogenase domain II, 99.08
COG1635 262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.56
KOG0029|consensus 501 98.55
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.52
PLN02487 569 zeta-carotene desaturase 98.51
PRK04176 257 ribulose-1,5-biphosphate synthetase; Provisional 98.51
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.5
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 98.47
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.46
PF01946 230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.45
PLN02852 491 ferredoxin-NADP+ reductase 98.45
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 98.45
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.43
PRK11883 451 protoporphyrinogen oxidase; Reviewed 98.42
PRK07233 434 hypothetical protein; Provisional 98.42
TIGR00292 254 thiazole biosynthesis enzyme. This enzyme is invol 98.42
TIGR02032 295 GG-red-SF geranylgeranyl reductase family. This mo 98.41
PRK10262 321 thioredoxin reductase; Provisional 98.4
PRK07045 388 putative monooxygenase; Reviewed 98.39
PRK06475 400 salicylate hydroxylase; Provisional 98.39
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.39
PRK10157 428 putative oxidoreductase FixC; Provisional 98.38
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 98.38
PRK06847 375 hypothetical protein; Provisional 98.38
TIGR01292 300 TRX_reduct thioredoxin-disulfide reductase. This m 98.37
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 98.37
PRK07236 386 hypothetical protein; Provisional 98.37
PRK09126 392 hypothetical protein; Provisional 98.37
PRK10015 429 oxidoreductase; Provisional 98.37
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.36
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.36
PRK06753 373 hypothetical protein; Provisional 98.35
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.35
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 98.35
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.35
PRK07208 479 hypothetical protein; Provisional 98.34
PRK08163 396 salicylate hydroxylase; Provisional 98.34
PF07992 201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.34
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.34
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.34
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 98.33
PRK08013 400 oxidoreductase; Provisional 98.33
PLN02268 435 probable polyamine oxidase 98.32
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.32
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.31
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 98.31
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.3
PRK06126 545 hypothetical protein; Provisional 98.3
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.29
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.29
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.29
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 98.29
PRK07588 391 hypothetical protein; Provisional 98.29
PRK06184 502 hypothetical protein; Provisional 98.29
COG0665 387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.28
PLN02576 496 protoporphyrinogen oxidase 98.28
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.28
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.28
COG0492 305 TrxB Thioredoxin reductase [Posttranslational modi 98.27
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.27
PLN02463 447 lycopene beta cyclase 98.27
PRK08244 493 hypothetical protein; Provisional 98.26
PRK11259 376 solA N-methyltryptophan oxidase; Provisional 98.26
PRK07538 413 hypothetical protein; Provisional 98.25
PRK06185 407 hypothetical protein; Provisional 98.25
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.25
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 98.24
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.24
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 98.24
PRK06116 450 glutathione reductase; Validated 98.23
PRK05868 372 hypothetical protein; Validated 98.23
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 98.22
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.22
PLN02612 567 phytoene desaturase 98.22
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.22
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.21
COG3349 485 Uncharacterized conserved protein [Function unknow 98.21
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.2
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 98.2
TIGR03364 365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.2
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 98.2
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.18
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 98.18
PTZ00188 506 adrenodoxin reductase; Provisional 98.18
PRK06834 488 hypothetical protein; Provisional 98.17
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.17
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 98.17
PRK08132 547 FAD-dependent oxidoreductase; Provisional 98.16
PLN02985 514 squalene monooxygenase 98.16
PLN02697 529 lycopene epsilon cyclase 98.15
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 98.15
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.14
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 98.14
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.13
COG2081 408 Predicted flavoproteins [General function predicti 98.13
KOG1399|consensus 448 98.13
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.13
PRK07190 487 hypothetical protein; Provisional 98.12
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.12
PRK06370 463 mercuric reductase; Validated 98.12
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 98.11
PRK14694 468 putative mercuric reductase; Provisional 98.11
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 98.11
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 98.1
PRK11445 351 putative oxidoreductase; Provisional 98.1
PRK12416 463 protoporphyrinogen oxidase; Provisional 98.1
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 98.1
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.09
PTZ00367 567 squalene epoxidase; Provisional 98.09
PRK11728 393 hydroxyglutarate oxidase; Provisional 98.08
PRK12770 352 putative glutamate synthase subunit beta; Provisio 98.07
TIGR02053 463 MerA mercuric reductase. This model represents the 98.07
TIGR01373 407 soxB sarcosine oxidase, beta subunit family, heter 98.06
KOG2614|consensus 420 98.06
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 98.05
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 98.04
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 98.04
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 98.03
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 98.03
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.03
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.02
PLN02529 738 lysine-specific histone demethylase 1 98.02
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 98.02
PRK13977 576 myosin-cross-reactive antigen; Provisional 98.02
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.01
PTZ00052 499 thioredoxin reductase; Provisional 98.0
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 98.0
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.0
PLN02661 357 Putative thiazole synthesis 98.0
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreducta 97.99
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 97.99
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 97.99
PRK08274 466 tricarballylate dehydrogenase; Validated 97.98
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 97.98
PRK13748 561 putative mercuric reductase; Provisional 97.98
PRK08294 634 phenol 2-monooxygenase; Provisional 97.98
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.96
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 97.96
PLN02328 808 lysine-specific histone demethylase 1 homolog 97.95
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 97.95
TIGR00031 377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.93
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 97.91
PRK06996 398 hypothetical protein; Provisional 97.91
PRK08401 466 L-aspartate oxidase; Provisional 97.91
PF05834 374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.9
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.9
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 97.87
PRK07121 492 hypothetical protein; Validated 97.87
PLN02464 627 glycerol-3-phosphate dehydrogenase 97.86
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 97.86
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 97.85
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.84
COG3380 331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.84
PLN02507 499 glutathione reductase 97.83
PLN02568 539 polyamine oxidase 97.82
PRK12842 574 putative succinate dehydrogenase; Reviewed 97.82
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 97.82
PLN02676 487 polyamine oxidase 97.81
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 97.81
PTZ00058 561 glutathione reductase; Provisional 97.8
TIGR01789 370 lycopene_cycl lycopene cyclase. This model represe 97.79
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 97.79
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 97.79
PLN02546 558 glutathione reductase 97.78
PRK14727 479 putative mercuric reductase; Provisional 97.73
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 97.72
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.71
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 97.71
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 97.71
PRK07804 541 L-aspartate oxidase; Provisional 97.7
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 97.7
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 97.7
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 97.69
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 97.69
PF00732 296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.67
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 97.66
PRK12839 572 hypothetical protein; Provisional 97.66
PRK05329 422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.65
PRK07845 466 flavoprotein disulfide reductase; Reviewed 97.65
PLN03000 881 amine oxidase 97.65
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.64
COG2907 447 Predicted NAD/FAD-binding protein [General functio 97.64
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.63
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 97.63
COG3634 520 AhpF Alkyl hydroperoxide reductase, large subunit 97.63
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 97.63
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 97.62
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.62
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 97.62
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 97.6
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 97.59
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 97.58
PRK09564 444 coenzyme A disulfide reductase; Reviewed 97.56
KOG1276|consensus 491 97.56
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 97.55
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.55
PRK05257 494 malate:quinone oxidoreductase; Validated 97.53
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 97.53
PRK08275 554 putative oxidoreductase; Provisional 97.53
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 97.52
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 97.52
KOG0685|consensus 498 97.52
PF01210 157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 97.52
PTZ00153 659 lipoamide dehydrogenase; Provisional 97.52
KOG1800|consensus 468 97.5
PF04820 454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.47
PRK13512 438 coenzyme A disulfide reductase; Provisional 97.45
PLN02815 594 L-aspartate oxidase 97.44
KOG2820|consensus 399 97.44
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.43
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 97.43
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 97.42
PRK02106 560 choline dehydrogenase; Validated 97.42
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.4
PTZ00383 497 malate:quinone oxidoreductase; Provisional 97.39
PRK08071 510 L-aspartate oxidase; Provisional 97.39
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 97.38
COG1206 439 Gid NAD(FAD)-utilizing enzyme possibly involved in 97.38
PTZ00363 443 rab-GDP dissociation inhibitor; Provisional 97.38
TIGR03378 419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 97.38
COG3075 421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.37
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 97.37
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.37
PRK06175 433 L-aspartate oxidase; Provisional 97.36
PRK07395 553 L-aspartate oxidase; Provisional 97.36
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.36
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 97.34
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 97.34
KOG2415|consensus 621 97.33
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 97.33
PRK13339 497 malate:quinone oxidoreductase; Reviewed 97.33
PLN02976 1713 amine oxidase 97.32
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.31
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 97.3
COG0446 415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 97.29
COG0562 374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.28
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.27
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 97.27
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.27
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.22
PRK09077 536 L-aspartate oxidase; Provisional 97.21
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.2
PF02737 180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 97.11
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 97.11
PRK09897 534 hypothetical protein; Provisional 97.1
PF03721 185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.07
COG3573 552 Predicted oxidoreductase [General function predict 97.06
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 97.01
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 97.01
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 97.01
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 96.98
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 96.98
PF02558 151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 96.95
TIGR03169 364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 96.95
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 96.95
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 96.94
PRK07512 513 L-aspartate oxidase; Provisional 96.92
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 96.92
COG0579 429 Predicted dehydrogenase [General function predicti 96.88
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 96.87
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 96.85
TIGR01470 205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.82
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 96.8
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 96.8
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 96.75
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.75
PRK06719 157 precorrin-2 dehydrogenase; Validated 96.74
TIGR02053 463 MerA mercuric reductase. This model represents the 96.73
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.71
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 96.71
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 96.7
PRK12831 464 putative oxidoreductase; Provisional 96.68
PRK06370 463 mercuric reductase; Validated 96.67
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 96.67
KOG0404|consensus 322 96.66
KOG1298|consensus 509 96.66
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 96.65
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 96.65
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 96.65
PRK13512 438 coenzyme A disulfide reductase; Provisional 96.65
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 96.64
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 96.62
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.6
PRK07846 451 mycothione reductase; Reviewed 96.59
PRK13748 561 putative mercuric reductase; Provisional 96.59
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.57
PRK06718 202 precorrin-2 dehydrogenase; Reviewed 96.57
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.57
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 96.57
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.56
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.55
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 96.54
PRK09564 444 coenzyme A disulfide reductase; Reviewed 96.53
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 96.52
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.52
PRK14694 468 putative mercuric reductase; Provisional 96.51
PRK10262 321 thioredoxin reductase; Provisional 96.5
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 96.5
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 96.49
TIGR01292 300 TRX_reduct thioredoxin-disulfide reductase. This m 96.49
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 96.49
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 96.48
PRK07846 451 mycothione reductase; Reviewed 96.48
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 96.47
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 96.46
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.45
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.44
PRK12770 352 putative glutamate synthase subunit beta; Provisio 96.44
PTZ00052 499 thioredoxin reductase; Provisional 96.44
PRK14727 479 putative mercuric reductase; Provisional 96.41
PF01262 168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 96.41
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 96.4
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 96.4
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 96.39
PRK06116 450 glutathione reductase; Validated 96.39
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.38
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.37
PLN02785 587 Protein HOTHEAD 96.37
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.36
PRK14989 847 nitrite reductase subunit NirD; Provisional 96.35
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 96.35
COG0569 225 TrkA K+ transport systems, NAD-binding component [ 96.34
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.34
PRK07845 466 flavoprotein disulfide reductase; Reviewed 96.3
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.29
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 96.28
PRK14989 847 nitrite reductase subunit NirD; Provisional 96.27
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.24
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 96.21
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 96.2
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 96.19
PRK11749 457 dihydropyrimidine dehydrogenase subunit A; Provisi 96.17
KOG2852|consensus 380 96.15
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 96.15
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 96.11
KOG1399|consensus 448 96.1
PLN02507 499 glutathione reductase 96.09
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 96.07
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 96.06
cd01075 200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.04
KOG1335|consensus 506 96.02
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 96.02
PTZ00058 561 glutathione reductase; Provisional 95.96
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.96
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.94
PRK11730 715 fadB multifunctional fatty acid oxidation complex 95.93
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.92
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.91
PRK04148134 hypothetical protein; Provisional 95.91
KOG2960|consensus 328 95.89
PTZ00153 659 lipoamide dehydrogenase; Provisional 95.84
PLN02546 558 glutathione reductase 95.81
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 95.78
KOG2311|consensus 679 95.77
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 95.76
PRK05562 223 precorrin-2 dehydrogenase; Provisional 95.75
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 95.75
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 95.75
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.71
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.67
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 95.66
KOG3923|consensus 342 95.65
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 95.64
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 95.62
COG1893 307 ApbA Ketopantoate reductase [Coenzyme metabolism] 95.58
PRK12779 944 putative bifunctional glutamate synthase subunit b 95.57
TIGR02354 200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.57
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.56
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 95.56
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 95.55
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 95.51
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 95.49
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.48
PRK08306 296 dipicolinate synthase subunit A; Reviewed 95.46
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 95.46
cd01078 194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.45
KOG4716|consensus 503 95.39
TIGR02853 287 spore_dpaA dipicolinic acid synthetase, A subunit. 95.36
TIGR01087 433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 95.36
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 95.35
PRK12814 652 putative NADPH-dependent glutamate synthase small 95.33
KOG4254|consensus 561 95.31
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 95.27
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.27
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 95.23
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 95.22
PRK12549 284 shikimate 5-dehydrogenase; Reviewed 95.19
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 95.19
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 95.17
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 95.13
TIGR00507 270 aroE shikimate 5-dehydrogenase. This model finds p 95.12
KOG2844|consensus 856 95.11
PF13434 341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 95.08
PRK13984 604 putative oxidoreductase; Provisional 95.04
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 95.0
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 94.99
COG1250 307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 94.98
TIGR03376 342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 94.96
PLN02520 529 bifunctional 3-dehydroquinate dehydratase/shikimat 94.93
PF00899 135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.87
COG0492 305 TrxB Thioredoxin reductase [Posttranslational modi 94.87
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.84
PF03446 163 NAD_binding_2: NAD binding domain of 6-phosphogluc 94.83
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 94.8
PRK12548 289 shikimate 5-dehydrogenase; Provisional 94.8
PLN02695 370 GDP-D-mannose-3',5'-epimerase 94.78
TIGR01915 219 npdG NADPH-dependent F420 reductase. This model re 94.77
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 94.75
cd05311 226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 94.74
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 94.74
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 94.7
PRK00258 278 aroE shikimate 5-dehydrogenase; Reviewed 94.65
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 94.64
KOG2404|consensus 477 94.64
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 94.6
COG3634 520 AhpF Alkyl hydroperoxide reductase, large subunit 94.59
PTZ00082 321 L-lactate dehydrogenase; Provisional 94.58
PRK07417 279 arogenate dehydrogenase; Reviewed 94.58
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 94.55
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 94.52
PRK08017 256 oxidoreductase; Provisional 94.46
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 94.44
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 94.44
PLN02353 473 probable UDP-glucose 6-dehydrogenase 94.43
PF13460 183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 94.43
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 94.43
cd01487 174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 94.42
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 94.38
TIGR02356 202 adenyl_thiF thiazole biosynthesis adenylyltransfer 94.37
PRK06223 307 malate dehydrogenase; Reviewed 94.35
TIGR03169 364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 94.33
cd01065 155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 94.27
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 94.21
KOG2665|consensus 453 94.2
PRK14188 296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.19
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 94.16
PLN02572 442 UDP-sulfoquinovose synthase 94.16
PRK07523 255 gluconate 5-dehydrogenase; Provisional 94.12
PRK03815 401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.12
PRK07774 250 short chain dehydrogenase; Provisional 94.11
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 94.09
TIGR01809 282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 94.09
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 94.09
KOG2495|consensus 491 94.08
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 94.06
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.05
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 94.02
PLN02214 342 cinnamoyl-CoA reductase 94.02
PF06100 500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 94.01
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 94.0
PF07991 165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 94.0
PRK08644 212 thiamine biosynthesis protein ThiF; Provisional 93.97
PRK06057 255 short chain dehydrogenase; Provisional 93.96
COG1648 210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 93.93
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 93.93
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 93.93
PRK09496 453 trkA potassium transporter peripheral membrane com 93.93
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.88
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 93.87
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 93.86
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 93.86
COG1063 350 Tdh Threonine dehydrogenase and related Zn-depende 93.85
cd05211 217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 93.82
TIGR01082 448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 93.77
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 93.76
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 93.75
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 93.74
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 93.73
PRK15116 268 sulfur acceptor protein CsdL; Provisional 93.73
PLN02583 297 cinnamoyl-CoA reductase 93.72
PF00056 141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 93.68
TIGR01202 308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 93.63
PLN02896 353 cinnamyl-alcohol dehydrogenase 93.61
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 93.6
cd00757 228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 93.59
PTZ00117 319 malate dehydrogenase; Provisional 93.58
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.58
cd08230 355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 93.57
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 93.57
PRK10669 558 putative cation:proton antiport protein; Provision 93.57
cd05213 311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 93.56
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
Probab=99.87  E-value=3.9e-22  Score=145.80  Aligned_cols=80  Identities=66%  Similarity=1.105  Sum_probs=70.4

Q ss_pred             CccccCccchHHHhhcCCCCCccchhhHHHHHHHhhHhhCCCCCCCCCccCCCcEEEECCCHHHHHHHHHHhHcCCCeee
Q psy11001          1 FTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGSGPSGLGAAHQLNKEAGTELI   80 (81)
Q Consensus         1 ~~~riC~~~C~~~C~~~~~~~~i~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~v~viG~G~aG~~~A~~L~~~g~~v~v   80 (81)
                      ||||+|||||+.+|++...++||+|+.+++|+.++.....|..+..+.+...++|+|||+|+||+++|.+|+++|++|+|
T Consensus        92 ~~g~vC~~~Ce~~C~~~~~~~~v~i~~l~r~~~~~~~~~~~~~~~~~~~~~~~~VvIIGaGpAGl~aA~~l~~~G~~V~v  171 (471)
T PRK12810         92 FTGRVCPAPCEGACTLNINFGPVTIKNIERYIIDKAFEEGWVKPDPPVKRTGKKVAVVGSGPAGLAAADQLARAGHKVTV  171 (471)
T ss_pred             HhcCcCCchhHHhccCCCCCCCccHHHHHHHHHHHHHHcCCCCCCCCcCCCCCEEEEECcCHHHHHHHHHHHhCCCcEEE
Confidence            69999999999999999999999999999999998887776222233445678999999999999999999999999987



>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF14691 Fer4_20: Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster; PDB: 2VDC_G 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>KOG3923|consensus Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
2vdc_G 456 The 9.5 A Resolution Structure Of Glutamate Synthas 7e-07
>pdb|2VDC|G Chain G, The 9.5 A Resolution Structure Of Glutamate Synthase From Cryo-Electron Microscopy And Its Oligomerization Behavior In Solution: Functional Implications. Length = 456 Back     alignment and structure

Iteration: 1

Score = 48.9 bits (115), Expect = 7e-07, Method: Composition-based stats. Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 3/59 (5%) Query: 3 GRVCPAP--CEGACVL-GINEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIV 58 GR+CP CEG CV+ AVTI ++E I D A++QGW+KP P+ G V ++ Sbjct: 70 GRICPQDRLCEGNCVIEQSTHGAVTIGSVEKYINDTAWDQGWVKPRTPSRELGLSVGVI 128

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 5e-45
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 8e-24
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 7e-21
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 6e-08
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 1e-07
3utf_A 513 UDP-galactopyranose mutase; nucleotide binding, fl 7e-07
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 1e-06
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 3e-06
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 5e-06
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 9e-06
1rp0_A 284 ARA6, thiazole biosynthetic enzyme; protein ligand 2e-05
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 2e-05
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 3e-05
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 3e-05
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 3e-05
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 3e-05
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 4e-05
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 4e-05
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 4e-05
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 5e-05
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 6e-05
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 6e-05
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 7e-05
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 8e-05
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 1e-04
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 2e-04
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 2e-04
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 3e-04
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 3e-04
2gjc_A 326 Thiazole biosynthetic enzyme, mitochondrial; gluta 3e-04
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 3e-04
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 3e-04
3jsk_A 344 Cypbp37 protein; octameric thiazole synthase, bios 4e-04
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 6e-04
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 7e-04
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 8e-04
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 8e-04
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 8e-04
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 8e-04
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
 Score =  148 bits (376), Expect = 5e-45
 Identities = 33/76 (43%), Positives = 47/76 (61%), Gaps = 3/76 (3%)

Query: 1   FTGRVCPAP--CEGACVLGIN-EPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAI 57
             GR+CP    CEG CV+  +   AVTI ++E  I D A++QGW+KP  P+   G  V +
Sbjct: 68  ICGRICPQDRLCEGNCVIEQSTHGAVTIGSVEKYINDTAWDQGWVKPRTPSRELGLSVGV 127

Query: 58  VGSGPSGLGAAHQLNK 73
           +G+GP+GL AA +L  
Sbjct: 128 IGAGPAGLAAAEELRA 143


>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Length = 460 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Length = 584 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query81
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.86
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.74
2bry_A 497 NEDD9 interacting protein with calponin homology a 99.37
3fpz_A 326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.15
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 99.07
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 99.07
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 99.05
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 99.04
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 98.9
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.87
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 98.77
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 98.7
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.7
4fk1_A 304 Putative thioredoxin reductase; structural genomic 98.67
4a5l_A 314 Thioredoxin reductase; oxidoreductase, redox metab 98.66
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.62
4gcm_A 312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.62
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 98.59
2gjc_A 326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.58
4hb9_A 412 Similarities with probable monooxygenase; flavin, 98.58
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 98.58
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 98.56
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.51
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.51
3r9u_A 315 Thioredoxin reductase; structural genomics, center 98.49
3dme_A 369 Conserved exported protein; structural genomics, P 98.47
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 98.44
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 98.44
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 98.43
3fbs_A 297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.42
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 98.42
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 98.42
3f8d_A 323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.42
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 98.4
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 98.4
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 98.39
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.39
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.39
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 98.39
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.39
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.38
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.37
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 98.37
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 98.37
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 98.37
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.37
2cul_A 232 Glucose-inhibited division protein A-related PROT 98.36
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 98.36
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.36
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.36
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.36
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.35
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 98.33
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 98.33
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.33
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.33
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 98.32
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.32
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.32
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.32
3cty_A 319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.32
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.32
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 98.31
1trb_A 320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.31
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 98.31
2q7v_A 325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.31
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 98.31
1fl2_A 310 Alkyl hydroperoxide reductase subunit F; reactive 98.3
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 98.3
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.3
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.3
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.3
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 98.3
3atr_A 453 Conserved archaeal protein; saturating double bond 98.3
2a87_A 335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.29
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.29
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.29
1vdc_A 333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.28
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.28
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 98.28
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.28
2q0l_A 311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.27
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.27
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 98.27
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 98.27
2ywl_A 180 Thioredoxin reductase related protein; uncharacter 98.27
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.26
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.24
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 98.24
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 98.24
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 98.23
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.23
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.22
3jsk_A 344 Cypbp37 protein; octameric thiazole synthase, bios 98.22
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.22
4dna_A 463 Probable glutathione reductase; structural genomic 98.21
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 98.21
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.21
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.21
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 98.21
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.21
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.2
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 98.2
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 98.2
1rp0_A 284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.19
3g3e_A 351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.19
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.19
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.18
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 98.18
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.18
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 98.18
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.17
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.16
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.16
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.16
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 98.16
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.16
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.15
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 98.15
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 98.14
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.14
1fec_A 490 Trypanothione reductase; redox-active center, oxid 98.13
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.13
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.12
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 98.12
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 98.12
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 98.12
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.12
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.11
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.11
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 98.1
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.1
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.1
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.1
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 98.1
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.1
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.09
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 98.09
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 98.09
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.08
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.08
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 98.08
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.07
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 98.07
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.07
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.06
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.06
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.06
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 98.05
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 98.05
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.05
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 98.05
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.05
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.05
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.05
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 98.04
1ojt_A 482 Surface protein; redox-active center, glycolysis, 98.04
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.04
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.04
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.03
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 98.02
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.02
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 98.02
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.01
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 98.01
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.01
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.0
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 97.99
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.99
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.99
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 97.98
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 97.97
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.96
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 97.96
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.96
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.95
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.95
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.95
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.94
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 97.94
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 97.94
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 97.93
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.93
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 97.92
2v3a_A 384 Rubredoxin reductase; alkane degradation, NADH oxi 97.92
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 97.92
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.92
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.91
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 97.91
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 97.9
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.89
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.88
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.88
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.87
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 97.86
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.85
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.82
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.8
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.78
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 97.78
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.76
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 97.75
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.51
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 97.34
4gcm_A 312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.33
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 97.33
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.33
2g1u_A 155 Hypothetical protein TM1088A; structural genomics, 97.32
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 97.29
4a5l_A 314 Thioredoxin reductase; oxidoreductase, redox metab 97.28
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 97.28
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 97.28
3fwz_A 140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.27
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.17
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.17
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.13
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 97.11
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.09
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.04
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.03
3llv_A 141 Exopolyphosphatase-related protein; NAD(P)-binding 97.03
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 97.02
1lss_A 140 TRK system potassium uptake protein TRKA homolog; 96.99
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 96.98
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 96.97
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.97
2v3a_A 384 Rubredoxin reductase; alkane degradation, NADH oxi 96.96
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 96.95
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 96.95
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 96.93
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 96.93
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 96.93
2hmt_A 144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.92
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.91
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 96.88
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 96.88
1id1_A 153 Putative potassium channel protein; RCK domain, E. 96.88
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 96.86
3c85_A 183 Putative glutathione-regulated potassium-efflux S 96.86
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 96.85
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.83
2q0l_A 311 TRXR, thioredoxin reductase; bacterial thiredoxin 96.82
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 96.8
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 96.79
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 96.78
1ojt_A 482 Surface protein; redox-active center, glycolysis, 96.77
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 96.76
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 96.75
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.74
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 96.74
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 96.73
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 96.73
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 96.73
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 96.72
1fl2_A 310 Alkyl hydroperoxide reductase subunit F; reactive 96.72
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 96.71
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 96.69
2q7v_A 325 Thioredoxin reductase; rossman fold, FAD, flavopro 96.69
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 96.68
1trb_A 320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 96.67
1vdc_A 333 NTR, NADPH dependent thioredoxin reductase; hypoth 96.66
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 96.61
2a87_A 335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 96.61
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 96.61
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 96.59
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 96.58
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 96.57
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 96.57
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 96.56
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 96.55
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 96.55
1kyq_A 274 Met8P, siroheme biosynthesis protein Met8; homodim 96.55
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 96.55
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 96.54
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 96.54
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.53
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 96.53
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 96.52
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 96.5
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 96.5
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 96.49
3cty_A 319 Thioredoxin reductase; FAD, oxidoreductase, flavin 96.46
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 96.46
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 96.43
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 96.43
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 96.42
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 96.39
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 96.38
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 96.34
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 96.34
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 96.33
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 96.3
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 96.29
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 96.28
3fbs_A 297 Oxidoreductase; structural genomics, PSI2, MCSG, p 96.26
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 96.25
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 96.25
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 96.24
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 96.23
3f8d_A 323 Thioredoxin reductase (TRXB-3); redox protein, nuc 96.22
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 96.21
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 96.2
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 96.19
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.18
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 96.17
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 96.16
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 96.16
3r9u_A 315 Thioredoxin reductase; structural genomics, center 96.14
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 96.13
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 96.11
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 96.08
1fec_A 490 Trypanothione reductase; redox-active center, oxid 96.07
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 96.07
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 96.04
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 96.04
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 96.02
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 96.02
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 96.0
3g17_A 294 Similar to 2-dehydropantoate 2-reductase; structur 95.98
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 95.96
2raf_A 209 Putative dinucleotide-binding oxidoreductase; NP_7 95.94
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 95.94
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 95.93
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 95.92
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 95.92
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 95.91
1nyt_A 271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 95.9
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 95.88
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 95.87
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 95.87
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 95.85
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 95.85
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 95.84
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 95.83
4dna_A 463 Probable glutathione reductase; structural genomic 95.83
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 95.83
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 95.81
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 95.8
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 95.79
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 95.79
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 95.76
2vns_A 215 Metalloreductase steap3; metal-binding, transmembr 95.75
3p2y_A 381 Alanine dehydrogenase/pyridine nucleotide transhy; 95.75
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 95.71
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 95.7
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 95.69
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 95.65
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 95.62
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 95.61
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 95.61
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 95.59
3phh_A 269 Shikimate dehydrogenase; shikimate pathway, helico 95.59
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 95.58
2egg_A 297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 95.58
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 95.57
1p77_A 272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 95.55
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 95.53
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 95.5
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 95.5
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 95.49
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 95.49
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 95.49
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 95.45
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 95.45
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 95.42
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 95.41
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 95.38
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 95.35
3don_A 277 Shikimate dehydrogenase; alpha-beta structure, ros 95.35
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 95.29
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 95.28
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 95.27
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 95.26
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 95.25
3tnl_A 315 Shikimate dehydrogenase; structural genomics, cent 95.25
1jay_A 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 95.24
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 95.24
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 95.22
3d4o_A 293 Dipicolinate synthase subunit A; NP_243269.1, stru 95.21
1i36_A 264 Conserved hypothetical protein MTH1747; NADP bindi 95.2
3tl2_A 315 Malate dehydrogenase; center for structural genomi 95.18
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 95.17
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 95.17
3qha_A 296 Putative oxidoreductase; seattle structural genomi 95.17
2rir_A 300 Dipicolinate synthase, A chain; structural genomic 95.17
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 95.17
1lu9_A 287 Methylene tetrahydromethanopterin dehydrogenase; a 95.16
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 95.16
4huj_A 220 Uncharacterized protein; PSI-biology, nysgrc, stru 95.14
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 95.14
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 95.14
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 95.1
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 95.09
2hk9_A 275 Shikimate dehydrogenase; shikimate pathway, drug d 95.08
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 95.08
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 95.08
3pwz_A 272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 95.07
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 95.06
3jyo_A 283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 95.05
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 95.03
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 95.01
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 95.0
3t4e_A 312 Quinate/shikimate dehydrogenase; structural genomi 94.99
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 94.97
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 94.95
3fbt_A 282 Chorismate mutase and shikimate 5-dehydrogenase fu 94.93
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 94.91
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 94.91
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 94.9
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 94.9
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 94.89
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 94.89
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 94.88
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 94.86
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 94.86
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 94.85
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 94.83
3o8q_A 281 Shikimate 5-dehydrogenase I alpha; structural geno 94.82
2i6t_A 303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 94.82
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 94.81
2f00_A 491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 94.8
4ezb_A 317 Uncharacterized conserved protein; structural geno 94.77
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 94.76
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 94.75
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 94.75
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 94.73
1nvt_A 287 Shikimate 5'-dehydrogenase; structural genomics, P 94.72
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 94.72
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 94.71
1p3d_A 475 UDP-N-acetylmuramate--alanine ligase; alpha/beta p 94.69
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 94.68
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 94.67
1npy_A 271 Hypothetical shikimate 5-dehydrogenase-like protei 94.62
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 94.61
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 94.6
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 94.58
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 94.57
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 94.56
4g65_A 461 TRK system potassium uptake protein TRKA; structur 94.55
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 94.55
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 94.55
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 94.54
3ax6_A 380 Phosphoribosylaminoimidazole carboxylase, ATPase; 94.53
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 94.53
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 94.53
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 94.5
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 94.5
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 94.48
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 94.48
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 94.48
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 94.43
3u62_A 253 Shikimate dehydrogenase; shikimate pathway, oxidor 94.42
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 94.42
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 94.41
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 94.4
2d5c_A 263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 94.37
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 94.34
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 94.33
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 94.31
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 94.24
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 94.2
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 94.19
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 94.19
2dwc_A 433 PH0318, 433AA long hypothetical phosphoribosylglyc 94.18
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 94.17
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 94.12
3aw8_A 369 PURK, phosphoribosylaminoimidazole carboxylase, AT 94.12
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 94.11
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 94.1
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 94.09
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 94.09
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 94.08
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 94.07
1vl6_A 388 Malate oxidoreductase; TM0542, NAD-dependent malic 94.06
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 94.06
2aef_A 234 Calcium-gated potassium channel MTHK; rossmann fol 94.03
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 94.03
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 93.99
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 93.97
4a26_A 300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 93.94
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 93.94
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 93.94
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 93.94
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 93.93
1edz_A 320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 93.9
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 93.89
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 93.89
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 93.89
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 93.86
3nkl_A 141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 93.83
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 93.83
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 93.82
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 93.81
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 93.8
1pqw_A 198 Polyketide synthase; rossmann fold, dimer, structu 93.79
2o7s_A 523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 93.78
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 93.78
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 93.76
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 93.74
1a4i_A 301 Methylenetetrahydrofolate dehydrogenase / methenyl 93.7
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
Probab=99.86  E-value=4.9e-22  Score=143.65  Aligned_cols=80  Identities=41%  Similarity=0.814  Sum_probs=72.3

Q ss_pred             CccccCcc--chHHHhhcCCC-CCccchhhHHHHHHHhhHhhCCCCCCCCCccCCCcEEEECCCHHHHHHHHHHhHcCCC
Q psy11001          1 FTGRVCPA--PCEGACVLGIN-EPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGSGPSGLGAAHQLNKEAGT   77 (81)
Q Consensus         1 ~~~riC~~--~C~~~C~~~~~-~~~i~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~v~viG~G~aG~~~A~~L~~~g~~   77 (81)
                      ||||+||+  |||.+|+++.. ++||.|+.+++++.+..+..+|..+..+.+.+.++|+||||||||+++|++|+++|++
T Consensus        68 ~~grvCp~~~~Ce~~C~~~~~~~~~v~I~~le~~~~~~~~~~~~~~~~~~~~~~~~~V~IIGgGpAGl~aA~~L~~~G~~  147 (456)
T 2vdc_G           68 ICGRICPQDRLCEGNCVIEQSTHGAVTIGSVEKYINDTAWDQGWVKPRTPSRELGLSVGVIGAGPAGLAAAEELRAKGYE  147 (456)
T ss_dssp             HHHHHCCGGGSGGGGCGGGGSSSCSCCHHHHHHHHHHHHHHHTCCCCCCSCSSCCCCEEEECCSHHHHHHHHHHHHHTCC
T ss_pred             cccccCCCCcchHHhcccCCCCCCCccHHHHHHHHHHHHHHcCCCCCCCCcCCCCCEEEEECCCHHHHHHHHHHHHCCCe
Confidence            58999999  99999999987 9999999999999999888888765444446678999999999999999999999999


Q ss_pred             eee
Q psy11001         78 ELI   80 (81)
Q Consensus        78 v~v   80 (81)
                      |+|
T Consensus       148 V~v  150 (456)
T 2vdc_G          148 VHV  150 (456)
T ss_dssp             EEE
T ss_pred             EEE
Confidence            987



>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 81
d1gtea1182 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, 3e-16
d2gjca1 311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 9e-13
d1djqa3 233 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehyd 2e-12
d1rp0a1 278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 5e-10
d2bi7a1 314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 6e-07
d1seza1 373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 6e-07
d2gv8a1 335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 1e-06
d2iida1 370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 2e-06
d1gtea4 196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 3e-06
d2dw4a2 449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 3e-06
d1lqta2 239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 6e-06
d1cjca2 230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 1e-05
d1i8ta1 298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 3e-05
d2ivda1 347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 3e-05
d1w4xa1 298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 7e-05
d1b5qa1 347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 8e-05
d2v5za1 383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 3e-04
d2voua1 265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 4e-04
d1k0ia1 292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 7e-04
d1ps9a3 179 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu 0.002
d3c96a1 288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 0.003
>d1gtea1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 182 Back     information, alignment and structure

class: All alpha proteins
fold: Globin-like
superfamily: alpha-helical ferredoxin
family: Dihydropyrimidine dehydrogenase, N-terminal domain
domain: Dihydropyrimidine dehydrogenase, N-terminal domain
species: Pig (Sus scrofa) [TaxId: 9823]
 Score = 66.9 bits (163), Expect = 3e-16
 Identities = 13/58 (22%), Positives = 22/58 (37%), Gaps = 3/58 (5%)

Query: 1   FTGRVCPAP--CEGACVLG-INEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKV 55
             G VCP    C G C L    E ++ I  ++    +        +   P L + +K+
Sbjct: 124 TCGMVCPTSDLCVGGCNLYATEEGSINIGGLQQFASEVFKAMNIPQIRNPCLPSQEKM 181


>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 233 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query81
d1djqa3 233 Trimethylamine dehydrogenase, middle domain {Methy 99.37
d1ps9a3 179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.37
d2gjca1 311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 99.15
d1gtea1182 Dihydropyrimidine dehydrogenase, N-terminal domain 99.12
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.08
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.08
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 99.04
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.99
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.98
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.97
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.93
d1gtea4 196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.92
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.91
d3lada1 229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.87
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.87
d1lqta2 239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.82
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.8
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.79
d1v59a1 233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.74
d2i0za1 251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.74
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.73
d1dxla1 221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.73
d1cjca2 230 Adrenodoxin reductase of mitochondrial p450 system 98.72
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.72
d1h6va1 235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.7
d1vdca1 192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.7
d1trba1 190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.7
d1ojta1 229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.69
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 98.67
d1rp0a1 278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.67
d2gqfa1 253 Hypothetical protein HI0933 {Haemophilus influenza 98.67
d1fl2a1 184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.66
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.66
d1gesa1 217 Glutathione reductase {Escherichia coli [TaxId: 56 98.62
d1ebda1 223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.62
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.6
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 98.59
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.57
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.55
d1kifa1 246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 98.54
d3grsa1 221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.54
d1lvla1 220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.51
d2cula1 230 GidA-related protein TTHA1897 {Thermus thermophilu 98.5
d1aoga1 238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.49
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.44
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.43
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.42
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.4
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 98.4
d1onfa1 259 Glutathione reductase {Plasmodium falciparum [TaxI 98.4
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 98.4
d1feca1 240 Trypanothione reductase {Crithidia fasciculata [Ta 98.39
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 98.38
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.38
d1fcda1 186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.3
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.28
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.28
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 98.27
d1q1ra1 185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.26
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.25
d1chua2 305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.25
d1mo9a1 261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.24
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 98.23
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.22
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 98.21
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.21
d1jnra2 356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.19
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.18
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.16
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.13
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.13
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.1
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.08
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.06
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 98.06
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.05
d1e5qa1 182 Saccharopine reductase {Rice blast fungus (Magnapo 98.05
d1bg6a2 184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.01
d1xdia1 233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.01
d1d7ya1 183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.99
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.93
d1kf6a2 311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.91
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.91
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.83
d1xhca1 167 NADH oxidase /nitrite reductase {Pyrococcus furios 97.79
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.73
d1nhpa1 198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.7
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 97.63
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.6
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.56
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.53
d1f0ya2 192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.52
d1ks9a2 167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.52
d1ju2a1 351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.49
d1w4xa2 235 Phenylacetone monooxygenase {Thermobifida fusca [T 97.46
d1wdka3 186 Fatty oxidation complex alpha subunit, middle doma 97.4
d1m6ia1 213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.4
d1kyqa1 150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 97.36
d1txga2 180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.31
d1mv8a2 202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.31
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.29
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.29
d2hmva1 134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.28
d1ps9a2 162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.27
d1n1ea2 189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.14
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 97.06
d1lssa_ 132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.02
d1jaya_ 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.01
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 96.89
d2f1ka2 165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.88
d2pv7a2 152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.84
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 96.73
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 96.72
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 96.63
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 96.57
d1nyta1 170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.56
d1dlja2 196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 96.55
d1pjca1 168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.48
d1l7da1 183 Nicotinamide nucleotide transhydrogenase dI compon 96.38
d1pzga1 154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.37
d1e3ja2 170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.37
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 96.37
d1llua2 166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.35
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 96.31
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 96.28
d1ldna1 148 Lactate dehydrogenase {Bacillus stearothermophilus 96.21
d1uxja1 142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.16
d1pl8a2 171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.15
d1ez4a1 146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.14
d1piwa2 168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.13
d1hyha1 146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.1
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 96.08
d3cuma2 162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.08
d1pgja2 178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.07
d1uufa2 168 Hypothetical protein YahK {Escherichia coli [TaxId 96.03
d1vpda2 161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.02
d1npya1 167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.02
d1gpja2 159 Glutamyl tRNA-reductase middle domain {Archaeon Me 95.99
d2g5ca2 171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 95.99
d1i36a2 152 Conserved hypothetical protein MTH1747 {Archaeon M 95.97
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 95.96
d1f8fa2 174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.94
d1rjwa2 168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.93
d2pgda2 176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 95.92
d1vj0a2 182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.89
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 95.74
d1y6ja1 142 Lactate dehydrogenase {Clostridium thermocellum [T 95.66
d1i0za1 160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.62
d1hdoa_ 205 Biliverdin IX beta reductase {Human (Homo sapiens) 95.62
d1jqba2 174 Bacterial secondary alcohol dehydrogenase {Clostri 95.56
d1e3ia2 174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.56
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 95.53
d1llda1 143 Lactate dehydrogenase {Bifidobacterium longum, str 95.49
d1vi2a1 182 Putative shikimate dehydrogenase YdiB {Escherichia 95.42
d1nvta1 177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.4
d1luaa1 191 Methylene-tetrahydromethanopterin dehydrogenase {M 95.37
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 95.13
d1p0fa2 174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.13
d1kola2 195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.09
d1id1a_ 153 Rck domain from putative potassium channel Kch {Es 95.09
d2a35a1 212 Hypothetical protein PA4017 {Pseudomonas aeruginos 94.99
d1p77a1 171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 94.98
d1h2ba2 172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 94.97
d2ldxa1 159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.94
d1guza1 142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 94.86
d1ojua1 142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 94.84
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 94.83
d1c1da1 201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 94.79
d1a5za1 140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 94.77
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 94.76
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 94.75
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 94.73
d1mlda1 144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 94.72
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 94.67
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.58
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 94.54
d1d1ta2 176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.51
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 94.5
d2fzwa2 176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.49
d1cdoa2 175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 94.4
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 94.27
d1hyea1 145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 94.21
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 94.15
d2ahra2 152 Pyrroline-5-carboxylate reductase ProC {Streptococ 94.13
d2jhfa2 176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 94.13
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 94.12
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 94.04
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 94.03
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 94.0
d1t2da1 150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 93.98
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 93.92
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 93.91
d1qp8a1 181 Putative formate dehydrogenase {Archaeon Pyrobacul 93.87
d1yb5a2 174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 93.86
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.86
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 93.62
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 93.57
d1o6za1 142 Malate dehydrogenase {Archaeon Haloarcula marismor 93.56
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 93.44
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 93.35
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 93.23
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 93.22
d1jvba2 170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 93.21
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 93.15
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 93.11
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 92.99
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 92.97
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 92.96
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 92.96
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 92.94
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 92.9
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 92.88
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 92.67
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 92.63
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 92.59
d1yqga2 152 Pyrroline-5-carboxylate reductase ProC {Neisseria 92.57
d1li4a1 163 S-adenosylhomocystein hydrolase {Human (Homo sapie 92.51
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 92.51
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 92.47
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 92.44
d1iz0a2 171 Quinone oxidoreductase {Thermus thermophilus [TaxI 92.41
d1ooea_ 235 Dihydropteridin reductase (pteridine reductase) {N 92.41
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 92.4
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 92.39
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 92.34
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 92.32
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 92.26
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 92.19
d1y7ta1 154 Malate dehydrogenase {Thermus thermophilus [TaxId: 92.17
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 92.17
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 92.11
d1lqta1 216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 92.05
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 92.02
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 92.01
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 91.99
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 91.93
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 91.93
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 91.88
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.79
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 91.78
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 91.74
d5mdha1 154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 91.68
d1np3a2 182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 91.62
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 91.61
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 91.59
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 91.58
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 91.56
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 91.55
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 91.51
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 91.5
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 91.36
d1pqwa_ 183 Putative enoyl reductase domain of polyketide synt 91.23
d1pjza_ 201 Thiopurine S-methyltransferase {Pseudomonas syring 91.19
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 91.18
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 91.15
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 91.09
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 91.07
d1vg0a1 491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 91.03
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 90.98
d1v8ba1 163 S-adenosylhomocystein hydrolase {Plasmodium falcip 90.96
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 90.9
d2cmda1 145 Malate dehydrogenase {Escherichia coli [TaxId: 562 90.82
d2gz1a1 154 Aspartate beta-semialdehyde dehydrogenase {Strepto 90.79
d1cjca1 225 Adrenodoxin reductase of mitochondrial p450 system 90.78
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 90.67
d2cvza2 156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 90.59
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 90.58
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 90.48
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 90.46
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 90.08
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 89.8
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 89.6
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 89.46
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 89.4
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 88.94
d1edza1 171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 88.87
d1j4aa1 197 D-lactate dehydrogenase {Lactobacillus helveticus 88.72
d1sc6a1 188 Phosphoglycerate dehydrogenase {Escherichia coli [ 88.68
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 88.6
d1vjta1 193 Putative alpha-glucosidase TM0752 {Thermotoga mari 88.52
d2hjsa1 144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 88.37
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 88.31
d7mdha1 175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 88.03
d1vl6a1 222 Malate oxidoreductase (malic enzyme) {Thermotoga m 87.96
d1mx3a1 193 Transcription corepressor CtbP {Human (Homo sapien 87.92
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 87.71
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 87.45
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 87.2
d1dxya1 199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 87.16
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 86.68
d2naca1 188 Formate dehydrogenase {Pseudomonas sp., strain 101 86.44
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 86.35
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 86.3
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 86.16
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 85.96
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 85.61
d1u7za_ 223 Coenzyme A biosynthesis bifunctional protein CoaBC 85.55
d1gdha1 191 D-glycerate dehydrogenase {Hyphomicrobium methylov 85.5
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 85.4
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 85.15
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 85.03
d1qora2 179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 84.81
d1gtma1 239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 84.7
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 84.66
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 84.57
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 84.48
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 84.48
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 84.3
d2bzga1 229 Thiopurine S-methyltransferase {Human (Homo sapien 84.13
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 83.78
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 83.68
d1b26a1 234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 83.24
d1a4ia1 170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 83.21
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 82.71
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 82.14
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 81.98
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 81.42
d1ygya1 184 Phosphoglycerate dehydrogenase {Mycobacterium tube 80.56
d1o0sa1 308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 80.28
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-binding domain
superfamily: Nucleotide-binding domain
family: N-terminal domain of adrenodoxin reductase-like
domain: Trimethylamine dehydrogenase, middle domain
species: Methylophilus methylotrophus, w3a1 [TaxId: 17]
Probab=99.37  E-value=6.7e-14  Score=90.94  Aligned_cols=74  Identities=27%  Similarity=0.415  Sum_probs=54.1

Q ss_pred             ccCccchHHHhhcCC-CCCccchhhHHHHHHHhhHhhCCCCCCCCCccCCCcEEEECCCHHHHHHHHHHhHcCCCeee
Q psy11001          4 RVCPAPCEGACVLGI-NEPAVTIKNIECAIIDHAFEQGWIKPEIPTLRTGKKVAIVGSGPSGLGAAHQLNKEAGTELI   80 (81)
Q Consensus         4 riC~~~C~~~C~~~~-~~~~i~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~v~viG~G~aG~~~A~~L~~~g~~v~v   80 (81)
                      |+|.. |+..|.+.. .+.++  .-++.....+....+|.+...+...+.++|+||||||||+++|.+|+++|++|+|
T Consensus         3 r~c~~-c~~c~~~~~~~~~~~--~c~~n~~~~~e~~~~~~p~~~~~~~~~k~VvIIGaGpAGl~aA~~l~~~G~~v~l   77 (233)
T d1djqa3           3 RVCIG-CNVCISRWEIGGPPM--ICTQNATAGEEYRRGWHPEKFRQTKNKDSVLIVGAGPSGSEAARVLMESGYTVHL   77 (233)
T ss_dssp             CCCCC-CCHHHHHHHHSSSCC--CCSSCTTTTTHHHHCCCSSCCCCCSSCCEEEEECCSHHHHHHHHHHHHTTCEEEE
T ss_pred             ccchh-hHHHHcccccCCcee--eeecCcccChHHhcCCCCCccCcccCCceEEEEcccHHHHHHHHHHHHhccceee
Confidence            67866 888787753 33443  2344444455566666654445556789999999999999999999999999987



>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gtea1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure