Diaphorina citri psyllid: psy11010

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------

MCVFQVVSYGRHTREELVVRLVAEMSRVKTSGAGHRGHSSGSGQHVAHHCRKKSRESRRLVLVIVAIALVLDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFAFGRTYGVLFLARSLQGIGSSCSSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPPFGGIMYQFVGKTAPFLILSALALGDGCKCNYTIVQKSSSHDRNINLDKWYAV

cEEEEEEEEccccccHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccHHcccccccHHHHHHHHHHHHHHHHHHHEEccccccccccccccccccc

MCVFQVVSYGRHTREELVVRLVAE**********************************RLVLVIVAIALVLDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFAFGRTYGVLFLARSLQGIGSSCSSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPPFGGIMYQFVGKTAPFLILSALALGDGCKCNYTIVQK*********LDKWYAV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Synaptic vesicular amine transporter	Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis.	confident	Q01827
Synaptic vesicular amine transporter	Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis.	confident	Q8BRU6
Synaptic vesicular amine transporter	Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis.	confident	Q27963

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0015842 [BP]	synaptic vesicle amine transport	probable	GO:0019226, GO:0035637, GO:0007268, GO:0032501, GO:0023052, GO:0015837, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0071705, GO:0051640, GO:0071702, GO:0097479, GO:0051641, GO:0009987, GO:0050877, GO:0006810, GO:0044765, GO:0008150, GO:0051648, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0003008, GO:0044700, GO:0016192, GO:0044707, GO:0044763
GO:0015844 [BP]	monoamine transport	probable	GO:0006810, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0005430 [MF]	synaptic vesicle amine transmembrane transporter activity	probable	GO:0022891, GO:0005275, GO:0005215, GO:0022857, GO:0022892, GO:0003674, GO:0022804
GO:0008021 [CC]	synaptic vesicle	probable	GO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0031594 [CC]	neuromuscular junction	probable	GO:0005575, GO:0045202
GO:0006812 [BP]	cation transport	probable	GO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0043005 [CC]	neuron projection	probable	GO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CFQ, chain A
Confidence level:very confident
Coverage over the Query: 85-232
View the alignment between query and template
View the model in PyMOL

Template: 1PW4, chain A
Confidence level:confident
Coverage over the Query: 55-242
View the alignment between query and template
View the model in PyMOL