Psyllid ID: psy11010


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MCVFQVVSYGRHTREELVVRLVAEMSRVKTSGAGHRGHSSGSGQHVAHHCRKKSRESRRLVLVIVAIALVLDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFAFGRTYGVLFLARSLQGIGSSCSSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPPFGGIMYQFVGKTAPFLILSALALGDGCKCNYTIVQKSSSHDRNINLDKWYAV
cEEEEEEEEccccccHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHcccccccHHHHHHHHHHHHHHHHHHHEEccccccccccccccccccc
ccEEEEEEHHHHccccccccHEEEEEEccccccccccccccccccccccccccccccccEEEEEEEEHHcccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHccccccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHccEEEEEEEccccccccccccccEEEc
MCVFQVVSYGRHTREELVVRLVAEMSRvktsgaghrghssgsgqhvahhcrkksresRRLVLVIVAIALVLDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAFVQLLANPLvgilthrvgyslpmFTGFVIMFLSTLIFAFGRTYGVLFLARSlqgigsscssvsgmgmlaerypddrergnAMGIALGGLALgvligppfggimyqfvgkTAPFLILSALAlgdgckcnytivqkssshdrninldkwyav
mcvfqvvsygrhtreeLVVRLVAEMSRVKTsgaghrghssgsgqhvahhcrkksresrrLVLVIVAIALVLDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFAFGRTYGVLFLARSLQGIGSSCSSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPPFGGIMYQFVGKTAPFLILSALALGDGCKCNYTivqkssshdrninldkwyav
MCVFQVVSYGRHTREELVVRLVAEMSRVKTsgaghrghssgsgqhVAHHCRKKSRESRRlvlvivaialvlDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFAFGRTYGVLFLARslqgigsscssvsgmgMLAERYPDDRERGNAMgialgglalgvligPPFGGIMYQFVGKTAPFLILSALALGDGCKCNYTIVQKSSSHDRNINLDKWYAV
*CVFQVVSYGRHTREELVVRLVAE**********************************RLVLVIVAIALVLDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFAFGRTYGVLFLARSLQGIGSSCSSVSGMGML**********GNAMGIALGGLALGVLIGPPFGGIMYQFVGKTAPFLILSALALGDGCKCNYTIVQK*********L**W***
MCVFQV*SYGR************************************************LVLVIVAIALVLDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFAFGRTYGVLFLARSLQGIGSSCSSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPPFGGIMYQFVGKTAPFLILSALALGDGCKCNYT*************LDKWYAV
MCVFQVVSYGRHTREELVVRLVAEMSRV***************************ESRRLVLVIVAIALVLDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFAFGRTYGVLFLARSLQGIGSSCSSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPPFGGIMYQFVGKTAPFLILSALALGDGCKCNYTIVQKSSSHDRNINLDKWYAV
MCVFQVVSYGRHTREELVVRLVAEMSRVKT****************AHHCRKKSRESRRLVLVIVAIALVLDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFAFGRTYGVLFLARSLQGIGSSCSSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPPFGGIMYQFVGKTAPFLILSALALGDGCKCNYTIVQKSSSHDRNINLDKWYAV
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCVFQVVSYGRHTREELVVRLVAEMSRVKTSGAGHRGHSSGSGQHVAHHCRKKSRESRRLVLVIVAIALVLDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFAFGRTYGVLFLARSLQGIGSSCSSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPPFGGIMYQFVGKTAPFLILSALALGDGCKCNYTIVQKSSSHDRNINLDKWYAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query256 2.2.26 [Sep-21-2011]
Q27963 517 Synaptic vesicular amine yes N/A 0.570 0.282 0.684 8e-52
Q8BRU6 517 Synaptic vesicular amine yes N/A 0.582 0.288 0.649 4e-50
Q01827 515 Synaptic vesicular amine yes N/A 0.593 0.295 0.636 1e-49
Q05940 514 Synaptic vesicular amine yes N/A 0.789 0.392 0.502 3e-49
Q08C75 513 Probable vesicular acetyl no N/A 0.851 0.424 0.387 2e-44
P81721 515 Vesicular acetylcholine t N/A N/A 0.699 0.347 0.412 1e-41
Q91498 511 Vesicular acetylcholine t N/A N/A 0.699 0.350 0.407 2e-41
Q91514 511 Vesicular acetylcholine t N/A N/A 0.675 0.338 0.414 9e-41
O17444 578 Vesicular acetylcholine t no N/A 0.671 0.297 0.439 1e-40
P59845 493 Probable vesicular acetyl no N/A 0.851 0.442 0.412 1e-38
>sp|Q27963|VMAT2_BOVIN Synaptic vesicular amine transporter OS=Bos taurus GN=SLC18A2 PE=1 SV=1 Back     alignment and function desciption
 Score =  203 bits (517), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 121/146 (82%)

Query: 85  ENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFA 144
            +  K L+ E   VG++F SKA VQLL NP +G+LT+R+GY +PMFTGF IMF+ST++FA
Sbjct: 121 PSEDKDLLNENVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMFTGFCIMFISTVMFA 180

Query: 145 FGRTYGVLFLARSLQGIGSSCSSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPP 204
           F RTY  L +ARSLQGIGSSCSSV+GMGMLA  Y DD ERGNAMGIALGGLA+GVL+GPP
Sbjct: 181 FSRTYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNAMGIALGGLAMGVLVGPP 240

Query: 205 FGGIMYQFVGKTAPFLILSALALGDG 230
           FG ++Y+FVGKTAPFL+L+AL L DG
Sbjct: 241 FGSVLYEFVGKTAPFLVLAALVLLDG 266




Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis.
Bos taurus (taxid: 9913)
>sp|Q8BRU6|VMAT2_MOUSE Synaptic vesicular amine transporter OS=Mus musculus GN=Slc18a2 PE=1 SV=1 Back     alignment and function description
>sp|Q01827|VMAT2_RAT Synaptic vesicular amine transporter OS=Rattus norvegicus GN=Slc18a2 PE=1 SV=2 Back     alignment and function description
>sp|Q05940|VMAT2_HUMAN Synaptic vesicular amine transporter OS=Homo sapiens GN=SLC18A2 PE=1 SV=2 Back     alignment and function description
>sp|Q08C75|VACHA_DANRE Probable vesicular acetylcholine transporter-A OS=Danio rerio GN=slc18a3a PE=2 SV=1 Back     alignment and function description
>sp|P81721|VACHT_TORCA Vesicular acetylcholine transporter OS=Torpedo californica PE=2 SV=2 Back     alignment and function description
>sp|Q91498|VACHT_TORMA Vesicular acetylcholine transporter OS=Torpedo marmorata PE=2 SV=2 Back     alignment and function description
>sp|Q91514|VACHT_TORTO Vesicular acetylcholine transporter OS=Torpedo torpedo PE=2 SV=1 Back     alignment and function description
>sp|O17444|VACHT_DROME Vesicular acetylcholine transporter OS=Drosophila melanogaster GN=VAChT PE=2 SV=2 Back     alignment and function description
>sp|P59845|VACHB_DANRE Probable vesicular acetylcholine transporter-B OS=Danio rerio GN=slc18a3b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
347971984 512 AGAP004476-PA [Anopheles gambiae str. PE 0.789 0.394 0.583 1e-70
328709288 478 PREDICTED: synaptic vesicular amine tran 0.675 0.361 0.630 7e-69
307198448 517 Chromaffin granule amine transporter [Ha 0.644 0.319 0.787 1e-68
307184508 513 Synaptic vesicular amine transporter [Ca 0.605 0.302 0.812 1e-68
383860874 521 PREDICTED: synaptic vesicular amine tran 0.589 0.289 0.821 4e-68
332028802 504 Synaptic vesicular amine transporter [Ac 0.609 0.309 0.797 5e-68
157119801 438 vesicular monoamine transporter, putativ 0.628 0.367 0.777 6e-68
345482461 505 PREDICTED: synaptic vesicular amine tran 0.601 0.304 0.818 1e-67
170043165 524 vesicular monoamine transporter [Culex q 0.574 0.280 0.850 4e-67
350403795 524 PREDICTED: synaptic vesicular amine tran 0.597 0.291 0.797 1e-66
>gi|347971984|ref|XP_313775.4| AGAP004476-PA [Anopheles gambiae str. PEST] gi|333469117|gb|EAA09208.4| AGAP004476-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 151/259 (58%), Positives = 169/259 (65%), Gaps = 57/259 (22%)

Query: 29  KTSGAGHRGHSSGSGQHVAHHCRKKS-----RESRRLVLVIVAIALVLDNMLLTTVEDV- 82
            +S  GH   SS            K+     R SR+LVLVIVAIAL+LDNMLLT V  + 
Sbjct: 16  SSSSTGHNHSSSPKLPPPGSWASLKANVIRWRGSRKLVLVIVAIALLLDNMLLTVVVPII 75

Query: 83  ---------------------------------------------------ARENRHKYL 91
                                                               RE RHK L
Sbjct: 76  PEFLYDIRHPDAPLASFPKTPPTTPCEKEVTTPYNGIDVTTQGYDNASWYAEREERHKEL 135

Query: 92  MGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFAFGRTYGV 151
           + ET  VG+MF SKAFVQLLANP+VG LTH++GYS+PMF GFVIMF+STLIFAFGRTY V
Sbjct: 136 VEETVEVGLMFASKAFVQLLANPIVGPLTHKIGYSIPMFAGFVIMFISTLIFAFGRTYSV 195

Query: 152 LFLARSLQGIGSSCSSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPPFGGIMYQ 211
           LFLAR+LQGIGSSCSSVSGMGMLA+RY DD+ERGNAMGIALGGLALGVLIGPPFGGIMY+
Sbjct: 196 LFLARALQGIGSSCSSVSGMGMLADRYTDDKERGNAMGIALGGLALGVLIGPPFGGIMYE 255

Query: 212 FVGKTAPFLILSALALGDG 230
           FVGK+APFL+LSALALGDG
Sbjct: 256 FVGKSAPFLVLSALALGDG 274




Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328709288|ref|XP_003243921.1| PREDICTED: synaptic vesicular amine transporter-like isoform 2 [Acyrthosiphon pisum] gi|328709290|ref|XP_001945866.2| PREDICTED: synaptic vesicular amine transporter-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307198448|gb|EFN79390.1| Chromaffin granule amine transporter [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307184508|gb|EFN70897.1| Synaptic vesicular amine transporter [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383860874|ref|XP_003705913.1| PREDICTED: synaptic vesicular amine transporter-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332028802|gb|EGI68831.1| Synaptic vesicular amine transporter [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157119801|ref|XP_001659513.1| vesicular monoamine transporter, putative [Aedes aegypti] gi|108875166|gb|EAT39391.1| AAEL008816-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|345482461|ref|XP_001608139.2| PREDICTED: synaptic vesicular amine transporter-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|170043165|ref|XP_001849269.1| vesicular monoamine transporter [Culex quinquefasciatus] gi|167866583|gb|EDS29966.1| vesicular monoamine transporter [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|350403795|ref|XP_003486906.1| PREDICTED: synaptic vesicular amine transporter-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
FB|FBgn0260964 646 Vmat "Vesicular monoamine tran 0.570 0.226 0.609 4.7e-46
WB|WBGene00000295 553 cat-1 [Caenorhabditis elegans 0.625 0.289 0.472 5.3e-38
UNIPROTKB|Q27963 517 SLC18A2 "Synaptic vesicular am 0.554 0.274 0.514 1.9e-37
UNIPROTKB|B0JYP2 517 SLC18A2 "Solute carrier family 0.554 0.274 0.507 5.1e-37
UNIPROTKB|I3L5W2 517 SLC18A2 "Uncharacterized prote 0.578 0.286 0.486 3.5e-36
UNIPROTKB|F1PD81 518 SLC18A2 "Uncharacterized prote 0.578 0.285 0.48 3.5e-36
MGI|MGI:106677 517 Slc18a2 "solute carrier family 0.593 0.294 0.483 5.7e-36
UNIPROTKB|F1P4R2 514 SLC18A2 "Uncharacterized prote 0.578 0.287 0.48 1.2e-35
UNIPROTKB|E1BWE7 522 SLC18A1 "Uncharacterized prote 0.554 0.272 0.507 3.3e-35
RGD|3694 515 Slc18a2 "solute carrier family 0.593 0.295 0.470 4.8e-35
FB|FBgn0260964 Vmat "Vesicular monoamine transporter" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 457 (165.9 bits), Expect = 4.7e-46, Sum P(2) = 4.7e-46
 Identities = 89/146 (60%), Positives = 105/146 (71%)

Query:    85 ENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFA 144
             E RH  L+GET  VG++F SKAFVQLL NP+VG LTHR+GYS+PMF GFVIMFLST+IFA
Sbjct:   226 EERHNELVGETVEVGLLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFA 285

Query:   145 FGRTYGVLFLARXXXXXXXXXXXXXXXXMLAERYPDDRERGNAMXXXXXXXXXXXXXXPP 204
             FGR+Y VLF+AR                MLA+R+ DD+ERGNAM              PP
Sbjct:   286 FGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPP 345

Query:   205 FGGIMYQFVGKTAPFLILSALALGDG 230
             FGG+MY+FVGK+APFLIL+ALALGDG
Sbjct:   346 FGGVMYEFVGKSAPFLILAALALGDG 371


GO:0008021 "synaptic vesicle" evidence=ISS;IDA
GO:0016021 "integral to membrane" evidence=ISS
GO:0008504 "monoamine transmembrane transporter activity" evidence=ISS;IDA
GO:0006836 "neurotransmitter transport" evidence=ISS
GO:0015238 "drug transmembrane transporter activity" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0015842 "synaptic vesicle amine transport" evidence=IDA
GO:0005430 "synaptic vesicle amine transmembrane transporter activity" evidence=IDA
GO:0015844 "monoamine transport" evidence=IDA
GO:0031594 "neuromuscular junction" evidence=IDA
GO:0015872 "dopamine transport" evidence=IMP
GO:0051608 "histamine transport" evidence=IMP
WB|WBGene00000295 cat-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q27963 SLC18A2 "Synaptic vesicular amine transporter" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B0JYP2 SLC18A2 "Solute carrier family 18 (Vesicular monoamine), member 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3L5W2 SLC18A2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PD81 SLC18A2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:106677 Slc18a2 "solute carrier family 18 (vesicular monoamine), member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4R2 SLC18A2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWE7 SLC18A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|3694 Slc18a2 "solute carrier family 18 (vesicular monoamine), member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8BRU6VMAT2_MOUSENo assigned EC number0.64900.58200.2882yesN/A
Q05940VMAT2_HUMANNo assigned EC number0.50230.78900.3929yesN/A
Q01827VMAT2_RATNo assigned EC number0.63630.59370.2951yesN/A
Q27963VMAT2_BOVINNo assigned EC number0.68490.57030.2823yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
TIGR00880141 TIGR00880, 2_A_01_02, Multidrug resistance protein 6e-36
cd06174 352 cd06174, MFS, The Major Facilitator Superfamily (M 2e-19
pfam07690 346 pfam07690, MFS_1, Major Facilitator Superfamily 2e-18
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 3e-12
COG2814 394 COG2814, AraJ, Arabinose efflux permease [Carbohyd 2e-11
TIGR00893 399 TIGR00893, 2A0114, D-galactonate transporter 3e-06
COG0477 338 COG0477, ProP, Permeases of the major facilitator 5e-06
TIGR00890 377 TIGR00890, 2A0111, oxalate/formate antiporter fami 2e-05
pfam07690346 pfam07690, MFS_1, Major Facilitator Superfamily 9e-05
TIGR00891 405 TIGR00891, 2A0112, putative sialic acid transporte 1e-04
TIGR00710 385 TIGR00710, efflux_Bcr_CflA, drug resistance transp 2e-04
PRK11652 394 PRK11652, emrD, multidrug resistance protein D; Pr 3e-04
TIGR00892455 TIGR00892, 2A0113, monocarboxylate transporter 1 3e-04
PRK14995 495 PRK14995, PRK14995, methyl viologen resistance pro 0.001
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 0.002
TIGR00711 485 TIGR00711, efflux_EmrB, drug resistance transporte 0.002
TIGR00894 465 TIGR00894, 2A0114euk, Na(+)-dependent inorganic ph 0.004
>gnl|CDD|233166 TIGR00880, 2_A_01_02, Multidrug resistance protein Back     alignment and domain information
 Score =  124 bits (313), Expect = 6e-36
 Identities = 57/132 (43%), Positives = 81/132 (61%), Gaps = 1/132 (0%)

Query: 99  GVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFAFGRTYGVLFLARSL 158
           G++    A  QL+ +PL G+LT R G    +  G  I  LST +FA      VL +AR L
Sbjct: 1   GLLLAGYALGQLIYSPLSGLLTDRFGRKPVLLVGLFIFVLSTAMFALSSNITVLIIARFL 60

Query: 159 QGIGSSCSSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPPFGGIMYQFVGKTAP 218
           QG G++ + V+G  ++A+ YP + ERG A+G+   G+ALG L+GPP GG++ QF+G  AP
Sbjct: 61  QGFGAAFALVAGAALIADIYPPE-ERGVALGLMSAGIALGPLLGPPLGGVLAQFLGWRAP 119

Query: 219 FLILSALALGDG 230
           FL L+ LAL   
Sbjct: 120 FLFLAILALAAF 131


Length = 141

>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|225371 COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|233174 TIGR00893, 2A0114, D-galactonate transporter Back     alignment and domain information
>gnl|CDD|223553 COG0477, ProP, Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|233171 TIGR00890, 2A0111, oxalate/formate antiporter family transporter Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|233172 TIGR00891, 2A0112, putative sialic acid transporter Back     alignment and domain information
>gnl|CDD|233099 TIGR00710, efflux_Bcr_CflA, drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>gnl|CDD|183259 PRK11652, emrD, multidrug resistance protein D; Provisional Back     alignment and domain information
>gnl|CDD|233173 TIGR00892, 2A0113, monocarboxylate transporter 1 Back     alignment and domain information
>gnl|CDD|184957 PRK14995, PRK14995, methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|129794 TIGR00711, efflux_EmrB, drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>gnl|CDD|129972 TIGR00894, 2A0114euk, Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 256
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.94
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.93
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.93
PRK03545 390 putative arabinose transporter; Provisional 99.93
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.92
KOG1330|consensus 493 99.92
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.91
PRK11663 434 regulatory protein UhpC; Provisional 99.91
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.91
TIGR00891 405 2A0112 putative sialic acid transporter. 99.91
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.91
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.91
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.91
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.91
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.9
PRK10091 382 MFS transport protein AraJ; Provisional 99.9
PRK05122 399 major facilitator superfamily transporter; Provisi 99.9
PRK12382 392 putative transporter; Provisional 99.9
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.9
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.9
PRK10504 471 putative transporter; Provisional 99.89
PRK10054 395 putative transporter; Provisional 99.89
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.89
PRK12307 426 putative sialic acid transporter; Provisional 99.89
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.89
PRK03699 394 putative transporter; Provisional 99.89
PLN00028 476 nitrate transmembrane transporter; Provisional 99.89
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.89
TIGR00900 365 2A0121 H+ Antiporter protein. 99.89
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.89
KOG3764|consensus 464 99.89
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.89
TIGR00893 399 2A0114 d-galactonate transporter. 99.89
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.88
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.88
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.88
PRK03893 496 putative sialic acid transporter; Provisional 99.88
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.88
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.88
PRK09705 393 cynX putative cyanate transporter; Provisional 99.88
PRK11043 401 putative transporter; Provisional 99.88
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.87
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.87
TIGR00895 398 2A0115 benzoate transport. 99.87
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.87
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.87
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.87
PRK09874 408 drug efflux system protein MdtG; Provisional 99.87
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.87
PRK10642 490 proline/glycine betaine transporter; Provisional 99.87
PRK09952 438 shikimate transporter; Provisional 99.87
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.86
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.86
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.86
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.86
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.85
PRK15075 434 citrate-proton symporter; Provisional 99.85
PRK10133 438 L-fucose transporter; Provisional 99.85
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.85
PRK03633 381 putative MFS family transporter protein; Provision 99.85
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.84
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.84
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.83
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.83
PRK15011 393 sugar efflux transporter B; Provisional 99.83
PRK10489 417 enterobactin exporter EntS; Provisional 99.83
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.83
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.83
KOG2532|consensus 466 99.83
TIGR00805 633 oat sodium-independent organic anion transporter. 99.82
TIGR00898 505 2A0119 cation transport protein. 99.81
KOG2533|consensus 495 99.8
PTZ00207 591 hypothetical protein; Provisional 99.8
KOG0254|consensus 513 99.79
TIGR00896 355 CynX cyanate transporter. This family of proteins 99.79
KOG2615|consensus 451 99.79
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.79
PRK15011393 sugar efflux transporter B; Provisional 99.79
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.78
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.77
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.76
PRK09528420 lacY galactoside permease; Reviewed 99.76
PRK10489417 enterobactin exporter EntS; Provisional 99.76
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.75
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 99.75
KOG0255|consensus 521 99.75
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.75
PRK05122399 major facilitator superfamily transporter; Provisi 99.75
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.75
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.75
PRK10642490 proline/glycine betaine transporter; Provisional 99.75
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.75
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.75
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 99.74
PRK03699394 putative transporter; Provisional 99.74
PRK11902 402 ampG muropeptide transporter; Reviewed 99.74
PRK11010 491 ampG muropeptide transporter; Validated 99.74
PRK09874408 drug efflux system protein MdtG; Provisional 99.74
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.74
TIGR00893399 2A0114 d-galactonate transporter. 99.74
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.74
PRK09528 420 lacY galactoside permease; Reviewed 99.73
PRK03545390 putative arabinose transporter; Provisional 99.73
KOG2504|consensus 509 99.73
PRK12382392 putative transporter; Provisional 99.73
PRK09705393 cynX putative cyanate transporter; Provisional 99.73
TIGR00901 356 2A0125 AmpG-related permease. 99.72
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 99.72
PRK03633381 putative MFS family transporter protein; Provision 99.72
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.72
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.71
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.7
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 99.7
TIGR00891405 2A0112 putative sialic acid transporter. 99.69
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.68
PRK11663434 regulatory protein UhpC; Provisional 99.68
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.68
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.68
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 99.67
PRK03893496 putative sialic acid transporter; Provisional 99.67
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.67
PRK09952438 shikimate transporter; Provisional 99.67
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.67
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.66
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.66
TIGR00897402 2A0118 polyol permease family. This family of prot 99.66
PRK10504471 putative transporter; Provisional 99.66
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.66
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.65
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.64
PRK15075434 citrate-proton symporter; Provisional 99.63
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.63
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.63
TIGR00900365 2A0121 H+ Antiporter protein. 99.62
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.62
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.61
KOG0252|consensus 538 99.61
TIGR00895398 2A0115 benzoate transport. 99.61
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 99.61
PRK12307426 putative sialic acid transporter; Provisional 99.6
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.6
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.6
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.6
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.6
PRK11010491 ampG muropeptide transporter; Validated 99.59
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.59
KOG2325|consensus 488 99.59
KOG0569|consensus 485 99.59
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.59
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.59
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.59
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 99.59
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.58
PRK10054395 putative transporter; Provisional 99.58
PRK10091382 MFS transport protein AraJ; Provisional 99.58
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 99.58
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.57
PLN00028476 nitrate transmembrane transporter; Provisional 99.56
KOG0253|consensus 528 99.56
PRK11902402 ampG muropeptide transporter; Reviewed 99.56
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.56
COG2270438 Permeases of the major facilitator superfamily [Ge 99.55
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.54
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.53
TIGR00896355 CynX cyanate transporter. This family of proteins 99.52
PRK09669 444 putative symporter YagG; Provisional 99.52
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.51
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.51
TIGR00898505 2A0119 cation transport protein. 99.5
PRK11646400 multidrug resistance protein MdtH; Provisional 99.5
PRK10133438 L-fucose transporter; Provisional 99.49
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.49
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.49
KOG0569|consensus485 99.48
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.47
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.47
PRK11195393 lysophospholipid transporter LplT; Provisional 99.47
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.47
TIGR00788 468 fbt folate/biopterin transporter. The only functio 99.45
PRK09848448 glucuronide transporter; Provisional 99.45
KOG2504|consensus509 99.44
KOG4686|consensus459 99.44
PF13347428 MFS_2: MFS/sugar transport protein 99.41
PRK10429 473 melibiose:sodium symporter; Provisional 99.41
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 99.4
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.4
PF13347 428 MFS_2: MFS/sugar transport protein 99.4
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.4
PRK11462 460 putative transporter; Provisional 99.39
COG2807395 CynX Cyanate permease [Inorganic ion transport and 99.39
KOG0253|consensus528 99.39
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 99.38
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.37
TIGR00901356 2A0125 AmpG-related permease. 99.37
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.36
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.35
PRK11043401 putative transporter; Provisional 99.33
PRK10429473 melibiose:sodium symporter; Provisional 99.32
PRK09669444 putative symporter YagG; Provisional 99.28
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 99.28
KOG3762|consensus618 99.28
PRK09848 448 glucuronide transporter; Provisional 99.27
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 99.25
KOG2532|consensus466 99.25
PRK11652394 emrD multidrug resistance protein D; Provisional 99.24
KOG3764|consensus464 99.23
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 99.22
KOG2563|consensus 480 99.22
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.17
COG2211467 MelB Na+/melibiose symporter and related transport 99.17
PRK09584500 tppB putative tripeptide transporter permease; Rev 99.16
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.16
COG2211 467 MelB Na+/melibiose symporter and related transport 99.15
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 99.1
PRK10207489 dipeptide/tripeptide permease B; Provisional 99.09
TIGR00788468 fbt folate/biopterin transporter. The only functio 99.08
COG0738422 FucP Fucose permease [Carbohydrate transport and m 99.08
PRK15403413 multidrug efflux system protein MdtM; Provisional 99.07
COG0477 338 ProP Permeases of the major facilitator superfamil 99.06
KOG2816|consensus 463 99.06
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.97
PRK11462460 putative transporter; Provisional 98.96
KOG3626|consensus 735 98.96
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.91
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.89
KOG0254|consensus513 98.87
KOG4686|consensus 459 98.84
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 98.82
KOG0252|consensus538 98.81
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.77
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.72
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 98.71
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 98.65
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 98.62
KOG2615|consensus451 98.62
KOG0637|consensus 498 98.61
KOG2533|consensus495 98.61
PF1283277 MFS_1_like: MFS_1 like family 98.59
KOG1237|consensus 571 98.58
PTZ00207591 hypothetical protein; Provisional 98.57
PRK15462493 dipeptide/tripeptide permease D; Provisional 98.56
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 98.52
KOG0255|consensus521 98.43
KOG2816|consensus463 98.39
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 98.36
COG2270 438 Permeases of the major facilitator superfamily [Ge 98.29
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 98.23
PRK03612 521 spermidine synthase; Provisional 98.19
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 98.06
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 98.02
TIGR00805633 oat sodium-independent organic anion transporter. 98.01
KOG2563|consensus480 97.89
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.82
KOG2325|consensus488 97.82
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 97.71
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 97.67
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 97.51
KOG4332|consensus 454 97.38
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 97.19
KOG3762|consensus 618 97.19
KOG3098|consensus 461 97.1
KOG3098|consensus461 97.05
KOG3574|consensus 510 96.99
KOG1330|consensus493 96.94
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 96.87
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 96.35
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 96.18
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 95.97
KOG3880|consensus 409 95.89
COG3202 509 ATP/ADP translocase [Energy production and convers 95.75
KOG0637|consensus498 95.72
KOG3626|consensus 735 95.42
PF01733309 Nucleoside_tran: Nucleoside transporter; InterPro: 95.39
KOG1479|consensus406 95.22
KOG3097|consensus 390 94.99
KOG4332|consensus454 94.93
PF13000 544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 94.54
TIGR00769472 AAA ADP/ATP carrier protein family. These proteins 94.37
KOG3810|consensus433 93.94
COG4262 508 Predicted spermidine synthase with an N-terminal m 93.64
KOG1479|consensus 406 93.64
KOG2601|consensus 503 93.47
KOG3810|consensus 433 92.74
TIGR00939 437 2a57 Equilibrative Nucleoside Transporter (ENT). 92.29
KOG3880|consensus409 92.25
TIGR00880141 2_A_01_02 Multidrug resistance protein. 89.09
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 88.2
PF13000544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 87.97
PRK10263 1355 DNA translocase FtsK; Provisional 84.61
COG5336116 Uncharacterized protein conserved in bacteria [Fun 84.61
KOG3574|consensus510 83.84
KOG1237|consensus571 82.98
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 80.2
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
Probab=99.94  E-value=1.1e-25  Score=184.49  Aligned_cols=182  Identities=24%  Similarity=0.302  Sum_probs=173.6

Q ss_pred             cccchHHHHHHHHHHHHHHhHhhhchhhhHHHHHhhhcCcchhHHHHHHHHHHHHHHhhhHHHHhhhhcCchhHHHHHHH
Q psy11010         55 RESRRLVLVIVAIALVLDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFV  134 (256)
Q Consensus        55 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~g~l~dr~G~r~~l~~~~~  134 (256)
                      ++..+..++.+.++.|..+.......+++|+. .+|+|.+..+.|+..+.|.++..++.|+...+.||+.||++++....
T Consensus         8 ~~~~~~~l~aLa~~~F~igttEfv~~gLLp~i-A~dl~vs~~~aG~lis~yAl~~ai~ap~l~~lt~r~~Rr~lLl~~l~   86 (394)
T COG2814           8 RKPMWLALLALALAAFAIGTTEFVPVGLLPPI-AADLGVSEGAAGQLITAYALGVALGAPLLALLTGRLERRRLLLGLLA   86 (394)
T ss_pred             cccchHHHHHHHHHHHHHHhHHHHHHhchHHH-HHHcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHcccchHHHHHHHHH
Confidence            34567778888899999899999998998886 79999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhchHHHHHHHHHHHHhhhhchhhhhhhhhhhcccCcchhhHHHHHHHHHHHHHHhhhhhHHhhhhhccC
Q psy11010        135 IMFLSTLIFAFGRTYGVLFLARSLQGIGSSCSSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPPFGGIMYQFVG  214 (256)
Q Consensus       135 ~~~~~~~~~~~~~~~~~~~~~~~l~G~~~g~~~~~~~~~~~~~~~~~~~r~~~~g~~~~~~~lg~~~g~~i~~~l~~~~g  214 (256)
                      +++++.+++++++|++.++++|++.|+..|..++...++..+..|+ ++|++++++...+..++.++|.+++.++.+.+|
T Consensus        87 lFi~~n~l~alAp~f~~Ll~aR~~~g~a~G~f~~i~~~~a~~lvpp-~~~~~Aiaiv~~G~tlA~v~GvPLGt~ig~~~G  165 (394)
T COG2814          87 LFIVSNLLSALAPSFAVLLLARALAGLAHGVFWSIAAALAARLVPP-GKRGRALALVFTGLTLATVLGVPLGTFLGQLFG  165 (394)
T ss_pred             HHHHHHHHHHHhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCc-cchhhHHHHHHHHHHHHHHHhccHHHHHHHHhh
Confidence            9999999999999999999999999999999999999999999998 999999999999999999999999999999999


Q ss_pred             chHHHHHHHHHHHHHHhHhhheee
Q psy11010        215 KTAPFLILSALALGDGCKCNYTIV  238 (256)
Q Consensus       215 ~~~~~~~~~~~~~~~~~~~~~~~~  238 (256)
                      ||++|++.++++++..+..+...|
T Consensus       166 WR~~F~~ia~l~ll~~~~~~~~lP  189 (394)
T COG2814         166 WRATFLAIAVLALLALLLLWKLLP  189 (394)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhCC
Confidence            999999999999999988888888



>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>KOG1237|consensus Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>KOG3574|consensus Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>KOG3880|consensus Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>PF01733 Nucleoside_tran: Nucleoside transporter; InterPro: IPR002259 Delayed-early response (DER) gene products include growth progression factors and several unknown products of novel cDNAs Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information
>KOG3097|consensus Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information
>KOG2601|consensus Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG3880|consensus Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3574|consensus Back     alignment and domain information
>KOG1237|consensus Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 2e-08
2cfq_A417 Lactose permease; transport, transport mechanism, 8e-08
2cfq_A 417 Lactose permease; transport, transport mechanism, 3e-05
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Length = 375 Back     alignment and structure
 Score = 53.0 bits (128), Expect = 2e-08
 Identities = 29/122 (23%), Positives = 51/122 (41%), Gaps = 5/122 (4%)

Query: 106 AFVQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFAFGRTYGVLFLARSLQGIGSSC 165
              QL   P+    + RVG    +  G  I  L+TL+     +  VL  A ++QG+G+  
Sbjct: 49  GVSQLFYGPI----SDRVGRRPVILVGMSIFMLATLVAVTTSSLTVLIAASAMQGMGTGV 104

Query: 166 SSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPPFGGIMYQFVGKTAPFLILSAL 225
             V    +  + Y +  +  +A  +   G+ +  L+ P  GG++       A +L L  L
Sbjct: 105 GGVMARTLPRDLY-ERTQLRHANSLLNMGILVSPLLAPLIGGLLDTMWNWRACYLFLLVL 163

Query: 226 AL 227
             
Sbjct: 164 CA 165


>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Length = 417 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Length = 417 Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Length = 451 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.93
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.93
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.91
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.91
2xut_A 524 Proton/peptide symporter family protein; transport 99.89
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.87
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.81
2cfq_A417 Lactose permease; transport, transport mechanism, 99.76
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.75
2cfq_A 417 Lactose permease; transport, transport mechanism, 99.69
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.65
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.6
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.5
2xut_A524 Proton/peptide symporter family protein; transport 99.24
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
Probab=99.93  E-value=1.2e-24  Score=184.30  Aligned_cols=179  Identities=16%  Similarity=0.197  Sum_probs=158.2

Q ss_pred             ccchHHHHHHHHHHHHHHhHhhhchhhhHHHHHhhhcCcchhHHHHHHHHHHHHHHhhhHHHHhhhhcCchhHHHHHHHH
Q psy11010         56 ESRRLVLVIVAIALVLDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFVI  135 (256)
Q Consensus        56 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~g~l~dr~G~r~~l~~~~~~  135 (256)
                      +++++.+..++++.+..++......+..|.+ .+++|.+..+.+++.+++.++..++.++.|+++||+|||++++.+.++
T Consensus        22 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~g~s~~~~g~~~~~~~~~~~i~~~~~G~l~dr~g~r~~l~~~~~~  100 (438)
T 3o7q_A           22 RSYIIPFALLCSLFFLWAVANNLNDILLPQF-QQAFTLTNFQAGLIQSAFYFGYFIIPIPAGILMKKLSYKAGIITGLFL  100 (438)
T ss_dssp             CTTHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHSCCCSHHHHHHHHHHHHHHHTTHHHHHHHHHHSCHHHHHHHHHHH
T ss_pred             hHhHHHHHHHHHHHHHHHHHHHhHHHHHHHH-HHHcCCCHHHHHHHHHHHHHHHHHHHHhHHHHHHHhcchHHHHHHHHH
Confidence            3455666667777777777777777777764 788999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHH---HhhchHHHHHHHHHHHHhhhhchhhhhhhhhhhcccCcchhhHHHHHHHHHHHHHHhhhhhHHhhhh-h
Q psy11010        136 MFLSTLIF---AFGRTYGVLFLARSLQGIGSSCSSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPPFGGIMY-Q  211 (256)
Q Consensus       136 ~~~~~~~~---~~~~~~~~~~~~~~l~G~~~g~~~~~~~~~~~~~~~~~~~r~~~~g~~~~~~~lg~~~g~~i~~~l~-~  211 (256)
                      .+++.+++   .++++++.++++|++.|++.+...+...+++.|++|+ ++|++++++.+....+|..++|.+++.+. +
T Consensus       101 ~~~~~~~~~~~~~~~~~~~l~~~~~l~G~~~~~~~~~~~~~~~~~~~~-~~r~~~~~~~~~~~~~g~~~g~~~~~~l~~~  179 (438)
T 3o7q_A          101 YALGAALFWPAAEIMNYTLFLVGLFIIAAGLGCLETAANPFVTVLGPE-SSGHFRLNLAQTFNSFGAIIAVVFGQSLILS  179 (438)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCS-TTHHHHHHHHHHHHHHHHHHHHHHTTHHHHT
T ss_pred             HHHHHHHHHhccccccHHHHHHHHHHHHhhHHHhhhhHHHHHHHHcCc-hhHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            99999999   8889999999999999999999999999999999998 99999999999999999999999999998 5


Q ss_pred             ccC-------------------------chHHHHHHHHHHHHHHhHhhhe
Q psy11010        212 FVG-------------------------KTAPFLILSALALGDGCKCNYT  236 (256)
Q Consensus       212 ~~g-------------------------~~~~~~~~~~~~~~~~~~~~~~  236 (256)
                      ..+                         ||+.|++.+++.++..++.++.
T Consensus       180 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~  229 (438)
T 3o7q_A          180 NVPHQSQDVLDKMSPEQLSAYKHSLVLSVQTPYMIIVAIVLLVALLIMLT  229 (438)
T ss_dssp             SSCCCCHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             ccccccccccccCCcchhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            554                         9999988887777666555443



>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 256
d1pv7a_417 f.38.1.2 (A:) Lactose permease {Escherichia coli [ 4e-09
d1pv7a_ 417 f.38.1.2 (A:) Lactose permease {Escherichia coli [ 5e-05
d1pw4a_ 447 f.38.1.1 (A:) Glycerol-3-phosphate transporter {Es 6e-05
d1pw4a_447 f.38.1.1 (A:) Glycerol-3-phosphate transporter {Es 7e-05
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Length = 417 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: LacY-like proton/sugar symporter
domain: Lactose permease
species: Escherichia coli [TaxId: 562]
 Score = 54.4 bits (129), Expect = 4e-09
 Identities = 23/182 (12%), Positives = 57/182 (31%), Gaps = 2/182 (1%)

Query: 48  HHCRKKSRESRRLVLVIVAIALVLDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAF 107
               +  R+ +   L +  I +     +          +        T+  G +      
Sbjct: 211 KLALELFRQPKLWFLSLYVIGVSCTYDVFDQQFANFFTSFFATGEQGTRVFGYVTTMGEL 270

Query: 108 VQLLANPLVGILTHRVGYSLPMFTGFVIMFLSTLIFAFGRTYGVLFLARSLQGIGSSCSS 167
           +         ++ +R+G    +     IM +  +  +F  +   + + ++L         
Sbjct: 271 LNASIMFFAPLIINRIGGKNALLLAGTIMSVRIIGSSFATSALEVVILKTLHMFEVPFLL 330

Query: 168 VSGMGMLAERYPDDRERGNAMGIALG-GLALGVLIGPPFGGIMYQFVGKTAPFLILSALA 226
           V     +  ++   R       +       L ++      G MY+ +G    +L+L  +A
Sbjct: 331 VGCFKYITSQFEV-RFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGAYLVLGLVA 389

Query: 227 LG 228
           LG
Sbjct: 390 LG 391


>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Length = 417 Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Length = 447 Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Length = 447 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.92
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.79
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.76
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.73
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.92  E-value=2.9e-24  Score=179.79  Aligned_cols=184  Identities=11%  Similarity=0.049  Sum_probs=155.5

Q ss_pred             cccchHHHHHHHHHHHHHHhHhhhchhhhHHHHHhhhcCcchhHHHHHHHHHHHHHHhhhHHHHhhhhcCchhHHHHHHH
Q psy11010         55 RESRRLVLVIVAIALVLDNMLLTTVEDVARENRHKYLMGETKAVGVMFGSKAFVQLLANPLVGILTHRVGYSLPMFTGFV  134 (256)
Q Consensus        55 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~g~l~dr~G~r~~l~~~~~  134 (256)
                      ++.+|..+..++++.+....+...+....| ++ +++|.+.+++|++.+++.+++.++++++|+++||+|||+++..+.+
T Consensus        20 ~~~~w~i~~~~~~~~~~~~~~~~~~~~~~p-~~-~~~g~s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~   97 (447)
T d1pw4a_          20 RRLRWQIFLGIFFGYAAYYLVRKNFALAMP-YL-VEQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLI   97 (447)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTSHHHHHH-HT-TSSTTCSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HH-HHhCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHH
Confidence            445666666666666666666555544444 44 4589999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhh----chHHHHHHHHHHHHhhhhchhhhhhhhhhhcccCcchhhHHHHHHHHHHHHHHhhhhhHHhhhh
Q psy11010        135 IMFLSTLIFAFG----RTYGVLFLARSLQGIGSSCSSVSGMGMLAERYPDDRERGNAMGIALGGLALGVLIGPPFGGIMY  210 (256)
Q Consensus       135 ~~~~~~~~~~~~----~~~~~~~~~~~l~G~~~g~~~~~~~~~~~~~~~~~~~r~~~~g~~~~~~~lg~~~g~~i~~~l~  210 (256)
                      +.+++.++++++    ++++.+++.|++.|++.+...+...+++.|++|+ ++|++++++.+.+..+|..++|.+++.+.
T Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~-~~r~~~~~~~~~~~~~g~~i~~~~~~~~~  176 (447)
T d1pw4a_          98 LAAAVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQ-KERGGIVSVWNCAHNVGGGIPPLLFLLGM  176 (447)
T ss_dssp             HHHHHHHHHHHCHHHHSSSSHHHHHHHHHHHHHHHTHHHHHHHHHTTCTT-THHHHHHHHHHHHHHHHHTSHHHHHHHHH
T ss_pred             HHHHHHhhccccchhhhhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHh-hcccccccccccccchhhhhhhhhhhhHh
Confidence            999999888765    4677899999999999999999999999999998 99999999999999999999999998877


Q ss_pred             hc-cCchHHHHHHHHHHHHHHhHhhheeecCC
Q psy11010        211 QF-VGKTAPFLILSALALGDGCKCNYTIVQKS  241 (256)
Q Consensus       211 ~~-~g~~~~~~~~~~~~~~~~~~~~~~~~~~~  241 (256)
                      +. .+|++.|++.+++.++..++.++..++.+
T Consensus       177 ~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~  208 (447)
T d1pw4a_         177 AWFNDWHAALYMPAFCAILVALFAFAMMRDTP  208 (447)
T ss_dssp             HHTCCSTTCTHHHHHHHHHHHHHHHHHCCCSS
T ss_pred             hhhhcccccchhhhhhHHHHHHHHHHhcccch
Confidence            65 47999999988888887777766665443



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure