Diaphorina citri psyllid: psy11026

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------

MGERKGTNKYYPPDYDPSVGGLNKFLGTHALRERARKLHMGIMIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDPGNLDYVIVSGARRQENRWNPLENEQIVPETKEVSRKLFDDPMYKLEHGTNDMSSSKSKASHLNKLLDRQESVWKNDFDANRVLRDSFRKKKKQLKALQDKDNALLSKSSLSLKLVPEHKNDIRLASLYKYQHVKPKLNVKLKAPSSSGVSRDQK

cccccccccccccccccccccccccccccHHHHHHHHcccccEEEEEEccccccccccccccccccccccccccccccccEEEEEEEEEccccccEEEEEEccccccEEEEccEECcccccccccccccccccHHHHHcccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccccccccccccccccccccccccccc

****KGTNKYYPPDYDPSVGGLNKFLGTHALRERARKLHMGIMIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDPGNLDYVIVSGARRQEN*************************************************LDRQESVWKNDFD****************************************KNDIRLASLYKYQHVK********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGERKGTNKYYPPDYDPSVGGLNKFLGTHALRERARKLHMGIMIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDPGNLDYVIVSGARRQENRWNPLENEQIVPETKEVSRKLFDDPMYKLEHGTNDMSSSKSKASHLNKLLDRQESVWKNDFDAxxxxxxxxxxxxxxxxxxxxxDNALLSKSSLSLKLVPEHKNDIRLASLYKYQHVKPKLNVKLKAPSSSGVSRDQK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Coiled-coil domain-containing protein 130 homolog		confident	Q7K0F0
Coiled-coil domain-containing protein 130 homolog		confident	Q09651
Coiled-coil domain-containing protein 130		confident	Q32PZ9

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0009615 [BP]	response to virus	probable	GO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0044732 [CC]	mitotic spindle pole body	probable	GO:0043234, GO:0005856, GO:0072686, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005816, GO:0044422, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630, GO:0005622

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZSO, chain A
Confidence level:probable
Coverage over the Query: 40-113
View the alignment between query and template
View the model in PyMOL