Diaphorina citri psyllid: psy11035


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MSTQVRPLQFKVLAECPVSNARTSVMTLPHHDVETPVFMPVGTKGTIKGILPQQLETLDCQIILGNTYHLGLKPVEK
cccccccEEEEEEEEcccccEEEEEEEcccccccccccccccccCCcccccHHHHHHccccCEEccccccccccccc
******PLQFKVLAECPVSNARTSVMTLPHHDVETPVFMPVGTKGTIKGILPQQLETLDCQIILGNTYHLGLKP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTQVRPLQFKVLAECPVSNARTSVMTLPHHDVETPVFMPVGTKGTIKGILPQQLETLDCQIILGNTYHLGLKPVEK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Queuine tRNA-ribosyltransferase Interacts with QTRTD1 to form an active queuine tRNA-ribosyltransferase. This enzyme exchanges queuine for the guanine at the wobble position of tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), thereby forming the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).confidentQ9JMA2
Queuine tRNA-ribosyltransferase Exchanges the guanine residue with 7-aminomethyl-7-deazaguanine in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). After this exchange, a cyclopentendiol moiety is attached to the 7-aminomethyl group of 7-deazaguanine, resulting in the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).confidentQ3BS37
Queuine tRNA-ribosyltransferase Interacts with qtrtd1 to form an active queuine tRNA-ribosyltransferase. This enzyme exchanges queuine for the guanine at the wobble position of tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), thereby forming the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).confidentQ28HC6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008479 [MF]queuine tRNA-ribosyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016763
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008616 [BP]queuosine biosynthetic processprobableGO:0009451, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0009163, GO:0034660, GO:0034470, GO:0046116, GO:1901360, GO:0006139, GO:0044710, GO:0044260, GO:1901657, GO:1901362, GO:0071704, GO:0010467, GO:0042455, GO:0006400, GO:0044281, GO:0018130, GO:0008033, GO:1901576, GO:0009987, GO:0006725, GO:0043412, GO:0008150, GO:0009116, GO:0008152, GO:0034654, GO:1901564, GO:0009119, GO:0055086, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0009058, GO:0044237, GO:0043170, GO:0006399, GO:0019438, GO:0006396, GO:1901659

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ASH, chain A
Confidence level:very confident
Coverage over the Query: 8-77
View the alignment between query and template
View the model in PyMOL