Diaphorina citri psyllid: psy11049

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------

MKEMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQELMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKCESQEKSTKVRCELCPSKDGALKRTDNNGWAHVVCALYIPEVRFGNVTSMEPILLEEIPPERFNKVCYICEENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGNYLDNVKYCGYCSHHYSKLVRKKGANIKPIPRDWNY

cccccccccccccccccccccccccccccccccccccccccccEEEccccccccccEEEEcccccccEEccccccccccccccccccccccccccccccEEEccccccccEECccccEEEEEEEccccEEEECcccccccEEEcccccccccccEEEccccccccccccccCEEEcccccccccccHHHHHHcccEEEECcccccccEEEEcccccccHHHHccccccccccccccc

*****GGCCVCSDDSGWAENPLVYCDGQGCN****QELMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKCESQEKSTKVRCELCPSKDGALKRTDNNGWAHVVCALYIPEVRFGNVTSMEPILLEEIPPERFNKVCYICEENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGNYLDNVKYCGYCSHHY********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein AF-10	Probably involved in transcriptional regulation. Binds to cruciform DNA.	confident	O54826
Protein AF-10	Probably involved in transcriptional regulation. In vitro or as fusion protein with MLL has transactivation activity. Binds to cruciform DNA.	confident	P55197
Uncharacterized protein F54F2.2, isoform a		confident	P34447

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043966 [BP]	histone H3 acetylation	probable	GO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0018394, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0008150, GO:0016568, GO:0016569
GO:0043982 [BP]	histone H4-K8 acetylation	probable	GO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0043983 [BP]	histone H4-K12 acetylation	probable	GO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0043981 [BP]	histone H4-K5 acetylation	probable	GO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0043984 [BP]	histone H4-K16 acetylation	probable	GO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0008270 [MF]	zinc ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0042393 [MF]	histone binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0070776 [CC]	MOZ/MORF histone acetyltransferase complex	probable	GO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043231, GO:0043234, GO:0032991, GO:0000123, GO:0043233, GO:0044464, GO:0070775, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KU3, chain A
Confidence level:very confident
Coverage over the Query: 37-92
View the alignment between query and template
View the model in PyMOL

Template: 2LQ6, chain A
Confidence level:confident
Coverage over the Query: 145-220
View the alignment between query and template
View the model in PyMOL

Template: 3V43, chain A
Confidence level:probable
Coverage over the Query: 7-91
View the alignment between query and template
View the model in PyMOL

Template: 4GNE, chain A
Confidence level:probable
Coverage over the Query: 38-118
View the alignment between query and template
View the model in PyMOL