Psyllid ID: psy11049

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MKEMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQELMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKCESQEKSTKVRCELCPSKDGALKRTDNNGWAHVVCALYIPEVRFGNVTSMEPILLEEIPPERFNKVCYICEENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGNYLDNVKYCGYCSHHYSKLVRKKGANIKPIPRDWNY
cccccccccccccccccccccccccccccccccccccccccccEEEccccccccccEEEEcccccccEEccccccccccccccccccccccccccccccEEEccccccccEEEccccEEEEEEEccccEEEEEcccccccEEEcccccccccccEEEccccccccccccccEEEEcccccccccccHHHHHHcccEEEEEcccccccEEEEcccccccHHHHHcccccccccccccc
ccccccccEEcccHHHHcccHHHHHHHHHHcccccccHHccccEEEcccccccccEEEEEcccccEEEEEHHcccccEccccccHHcccccccccccccEEEccccccccEEcccccEEEEEEEEEEcEEEEcccEEEcEEEEEcccHHHHHHHHHHHHHccccccHHccccEEEEccccccEEEEHHHHHHcccEEEEcccccccEEEEEEccccccccccccccccccccccccc
mkemlggccvcsddsgwaenplvycdgqgcnvaVHQELmlggccvcsddsgwaenplvycdgqgcnvaVHQACYGIVtvpvgswfcrkcesqekstkvrcelcpskdgalkrtdnngwAHVVCALYipevrfgnvtsmepilleeipperfnKVCYICeenghkasrskfgacmmcnkpgcrqqfHVTCAQTQGLLCEEagnyldnvkycgycshhYSKLVRkkganikpiprdwny
MKEMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQELMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKCEsqekstkvrcelcpskdgalkrtdnngWAHVVCALYIPEVRFGNVTSMEpilleeippeRFNKVCYICEENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGNYLDNVKYCGYCSHHYsklvrkkganikpiprdwny
MKEMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQELMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKCESQEKSTKVRCELCPSKDGALKRTDNNGWAHVVCALYIPEVRFGNVTSMepilleeippeRFNKVCYICEENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGNYLDNVKYCGYCSHHYSKLVRKKGANIKPIPRDWNY
****LGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQELMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKCESQEKSTKVRCELCPSKDGALKRTDNNGWAHVVCALYIPEVRFGNVTSMEPILLEEIPPERFNKVCYICEENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGNYLDNVKYCGYCSHHYSKLVRKKGA***********
******G*CVCSDD**********************ELMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKCESQEKSTKVRCELCPSKDGALKRTDNNGWAHVVCALYIPEVRFGNVTSMEPILLEEIPPERFNKVCYICEENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGNYLDNVKYCGYCSH**********************
MKEMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQELMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKC**********CELCPSKDGALKRTDNNGWAHVVCALYIPEVRFGNVTSMEPILLEEIPPERFNKVCYICEENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGNYLDNVKYCGYCSHHYSKLVRKKGANIKPIPRDWNY
*****GGCCVCSDDSGWAENPLVYCDGQGCN****QELMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKCESQEKSTKVRCELCPSKDGALKRTDNNGWAHVVCALYIPEVRFGNVTSMEPILLEEIPPERFNKVCYICEENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGNYLDNVKYCGYCSHHY********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQELMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKCESQEKSTKVRCELCPSKDGALKRTDNNGWAHVVCALYIPEVRFGNVTSMEPILLEEIPPERFNKVCYICEENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGNYLDNVKYCGYCSHHYSKLVRKKGANIKPIPRDWNY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query237 2.2.26 [Sep-21-2011]
O54826 1068 Protein AF-10 OS=Mus musc yes N/A 0.793 0.176 0.726 6e-88
P55197 1027 Protein AF-10 OS=Homo sap yes N/A 0.793 0.183 0.726 6e-88
P55198 1093 Protein AF-17 OS=Homo sap no N/A 0.763 0.165 0.725 1e-82
P34447 867 Uncharacterized protein F yes N/A 0.797 0.217 0.562 3e-67
P55201 1214 Peregrin OS=Homo sapiens no N/A 0.603 0.117 0.5 1e-40
Q9ULD4 1205 Bromodomain and PHD finge no N/A 0.755 0.148 0.415 2e-38
Q7YZH1 3241 PHD finger protein rhinoc no N/A 0.721 0.052 0.407 6e-35
O95696 1058 Bromodomain-containing pr no N/A 0.691 0.155 0.423 1e-33
Q803A0 829 Protein Jade-1 OS=Danio r no N/A 0.679 0.194 0.431 5e-33
Q12311 748 NuA3 HAT complex componen yes N/A 0.751 0.237 0.358 3e-31
>sp|O54826|AF10_MOUSE Protein AF-10 OS=Mus musculus GN=Mllt10 PE=1 SV=2 Back     alignment and function desciption
 Score =  323 bits (828), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 138/190 (72%), Positives = 162/190 (85%), Gaps = 2/190 (1%)

Query: 39  MLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKCESQEKSTKV 98
           M+GGCCVCSD+ GWAENPLVYCDG GC+VAVHQACYGIV VP G WFCRKCESQE++ +V
Sbjct: 21  MIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVPTGPWFCRKCESQERAARV 80

Query: 99  RCELCPSKDGALKRTDNNGWAHVVCALYIPEVRFGNVTSMEPILLEEIPPERFNKVCYIC 158
           RCELCP KDGALKRTDN GWAHVVCALYIPEV+F NV++MEPI+L+ +P +R+NK CYIC
Sbjct: 81  RCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTMEPIVLQSVPHDRYNKTCYIC 140

Query: 159 EENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGNYLDNVKYCGYCSHHYS 218
           +E G + S++  GACM CNK GCRQ FHVTCAQ  GLLCEE GN  DNV+YCGYC +H+S
Sbjct: 141 DEQG-RESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFS 199

Query: 219 KLVR-KKGAN 227
           KL + K+G+N
Sbjct: 200 KLKKSKRGSN 209
Probably involved in transcriptional regulation. Binds to cruciform DNA.
Mus musculus (taxid: 10090)
>sp|P55197|AF10_HUMAN Protein AF-10 OS=Homo sapiens GN=MLLT10 PE=1 SV=1 Back     alignment and function description
>sp|P55198|AF17_HUMAN Protein AF-17 OS=Homo sapiens GN=MLLT6 PE=1 SV=2 Back     alignment and function description
>sp|P34447|YM2A_CAEEL Uncharacterized protein F54F2.2, isoform a OS=Caenorhabditis elegans GN=F54F2.2/F54F2.3/F54F2.4 PE=2 SV=2 Back     alignment and function description
>sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 Back     alignment and function description
>sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 Back     alignment and function description
>sp|Q7YZH1|RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster GN=rno PE=1 SV=1 Back     alignment and function description
>sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 Back     alignment and function description
>sp|Q803A0|JADE1_DANRE Protein Jade-1 OS=Danio rerio GN=phf17 PE=2 SV=1 Back     alignment and function description
>sp|Q12311|NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTO1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
332029582 1032 Protein AF-10 [Acromyrmex echinatior] 0.805 0.185 0.814 7e-97
242020644 915 protein AF-10, putative [Pediculus human 0.805 0.208 0.809 1e-96
307188583 1031 Protein AF-10 [Camponotus floridanus] 0.805 0.185 0.809 1e-96
157119390 1273 mixed-lineage leukemia protein [Aedes ae 0.805 0.150 0.809 2e-96
383851380 1048 PREDICTED: uncharacterized protein LOC10 0.805 0.182 0.809 3e-96
380020775 1040 PREDICTED: uncharacterized protein LOC10 0.805 0.183 0.809 3e-96
322780792 1010 hypothetical protein SINV_01929 [Solenop 0.805 0.189 0.804 3e-96
350402118 1032 PREDICTED: hypothetical protein LOC10074 0.805 0.185 0.809 5e-96
350402114 1040 PREDICTED: hypothetical protein LOC10074 0.805 0.183 0.809 5e-96
328784777 1019 PREDICTED: hypothetical protein LOC72658 0.805 0.187 0.809 5e-96
>gi|332029582|gb|EGI69471.1| Protein AF-10 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  358 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 158/194 (81%), Positives = 170/194 (87%), Gaps = 3/194 (1%)

Query: 39  MLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKCESQEKSTKV 98
           MLGGCCVCSD+ GW ENPLVYCDGQGC VAVHQACYGIVTVP+G W+CRKCESQE+S +V
Sbjct: 4   MLGGCCVCSDERGWTENPLVYCDGQGCTVAVHQACYGIVTVPIGPWYCRKCESQERSARV 63

Query: 99  RCELCPSKDGALKRTDNNGWAHVVCALYIPEVRFGNVTSMEPILLEEIPPERFNKVCYIC 158
           RCELCPS+DGALKRT+  GWAHVVCALYIPEVRFGNVT+MEPI+LE IP ERF+K CYIC
Sbjct: 64  RCELCPSRDGALKRTNQAGWAHVVCALYIPEVRFGNVTTMEPIILELIPSERFSKTCYIC 123

Query: 159 EENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGNYLDNVKYCGYCSHHYS 218
           EE G K SR+  GACM CNK GCRQQFHVTCAQ  GLLCEEAGNYLDNVKYCGYC HHYS
Sbjct: 124 EEQG-KGSRANVGACMQCNKTGCRQQFHVTCAQALGLLCEEAGNYLDNVKYCGYCQHHYS 182

Query: 219 KLVRKKGANIKPIP 232
           KL  KKG N+K IP
Sbjct: 183 KL--KKGGNVKTIP 194

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242020644|ref|XP_002430762.1| protein AF-10, putative [Pediculus humanus corporis] gi|212515959|gb|EEB18024.1| protein AF-10, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307188583|gb|EFN73311.1| Protein AF-10 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|157119390|ref|XP_001659392.1| mixed-lineage leukemia protein [Aedes aegypti] gi|108875324|gb|EAT39549.1| AAEL008662-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|383851380|ref|XP_003701211.1| PREDICTED: uncharacterized protein LOC100880297 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380020775|ref|XP_003694254.1| PREDICTED: uncharacterized protein LOC100863652 [Apis florea] Back     alignment and taxonomy information
>gi|322780792|gb|EFZ10021.1| hypothetical protein SINV_01929 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350402118|ref|XP_003486373.1| PREDICTED: hypothetical protein LOC100747003 isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350402114|ref|XP_003486372.1| PREDICTED: hypothetical protein LOC100747003 isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|328784777|ref|XP_001122314.2| PREDICTED: hypothetical protein LOC726587 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
UNIPROTKB|E1C657 1080 MLLT10 "Uncharacterized protei 0.793 0.174 0.705 2.7e-77
UNIPROTKB|F1MLK4 1080 MLLT10 "Uncharacterized protei 0.793 0.174 0.7 7.1e-77
UNIPROTKB|E9PBP4 1011 MLLT10 "Protein AF-10" [Homo s 0.793 0.185 0.7 7.1e-77
UNIPROTKB|P55197 1027 MLLT10 "Protein AF-10" [Homo s 0.793 0.183 0.7 7.1e-77
UNIPROTKB|Q5VX90 1068 MLLT10 "AF10" [Homo sapiens (t 0.793 0.176 0.7 7.1e-77
MGI|MGI:1329038 1068 Mllt10 "myeloid/lymphoid or mi 0.793 0.176 0.7 7.1e-77
UNIPROTKB|E2R8B9 1093 MLLT6 "Uncharacterized protein 0.763 0.165 0.703 2.7e-73
UNIPROTKB|F1MLY5 1095 MLLT6 "Uncharacterized protein 0.763 0.165 0.703 2.7e-73
UNIPROTKB|E9PEP1 325 MLLT6 "Protein AF-17" [Homo sa 0.763 0.556 0.697 2.8e-73
UNIPROTKB|P55198 1093 MLLT6 "Protein AF-17" [Homo sa 0.763 0.165 0.697 7.6e-73
UNIPROTKB|E1C657 MLLT10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 778 (278.9 bits), Expect = 2.7e-77, P = 2.7e-77
 Identities = 134/190 (70%), Positives = 152/190 (80%)

Query:    39 MLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKCESQEKSTKV 98
             M+GGCCVCSD+ GWAENPLVYCDG GCNVAVHQACYGIV VP G WFCRKCESQE++ +V
Sbjct:    24 MIGGCCVCSDERGWAENPLVYCDGHGCNVAVHQACYGIVQVPTGPWFCRKCESQERAARV 83

Query:    99 RCELCPSKDGALKRTDNNGWAHVVCALYIPEVRFGNVTSMXXXXXXXXXXXRFNKVCYIC 158
             RCELCP KDGALKRTDN GWAHVVCALYIPEV+F NV +M           R+NK CYIC
Sbjct:    84 RCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVATMEPIVLQSVPHDRYNKTCYIC 143

Query:   159 EENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGNYLDNVKYCGYCSHHYS 218
             +E G + S++  GACM CNK GCRQ FHVTCAQ  GLLCEE GN  DNV+YCGYC +H+S
Sbjct:   144 DEQGRE-SKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFS 202

Query:   219 KLVR-KKGAN 227
             KL + K+G+N
Sbjct:   203 KLKKSKRGSN 212
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
UNIPROTKB|F1MLK4 MLLT10 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E9PBP4 MLLT10 "Protein AF-10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P55197 MLLT10 "Protein AF-10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VX90 MLLT10 "AF10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1329038 Mllt10 "myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8B9 MLLT6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MLY5 MLLT6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E9PEP1 MLLT6 "Protein AF-17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P55198 MLLT6 "Protein AF-17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O54826AF10_MOUSENo assigned EC number0.72630.79320.1760yesN/A
P34447YM2A_CAEELNo assigned EC number0.56280.79740.2179yesN/A
P55197AF10_HUMANNo assigned EC number0.72630.79320.1830yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
COG5141 669 COG5141, COG5141, PHD zinc finger-containing prote 2e-40
pfam13832109 pfam13832, zf-HC5HC2H_2, PHD-zinc-finger like doma 2e-36
pfam1377189 pfam13771, zf-HC5HC2H, PHD-like zinc-binding domai 1e-19
pfam1383133 pfam13831, PHD_2, PHD-finger 4e-06
pfam0062851 pfam00628, PHD, PHD-finger 0.002
>gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information 
 Score =  146 bits (369), Expect = 2e-40
 Identities = 64/183 (34%), Positives = 92/183 (50%), Gaps = 15/183 (8%)

Query: 39  MLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKCESQEKSTKV 98
               C  C+       N +V+CDG  C + VHQ+CYGI  +P G W CRKC   E   + 
Sbjct: 192 FDDICTKCTSTHNENSNAIVFCDG--CEICVHQSCYGIQFLPEGFWLCRKCIYGEYQIRC 249

Query: 99  RCELCPSKDGALKRTDNNGWAHVVCALYIPEVRFGNVTSMEPI-LLEEIPPERFNKVCYI 157
            C  CPS DGA K+T +  W HV+CA++ PE+ FG++ S +PI  +  +   R+   C I
Sbjct: 250 -CSFCPSSDGAFKQTSDGRWGHVICAMFNPELSFGHLLSKDPIDNIASVSSSRWKLGCLI 308

Query: 158 CEENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGL--LCEEAGN-YLDNVKYCGYCS 214
           C+E          G C+ C+   C + +HVTCA+  G   L   + N     + +   C 
Sbjct: 309 CKE--------FGGTCIQCSYFNCTRAYHVTCARRAGYFDLNIYSHNGISYCIDHEPLCR 360

Query: 215 HHY 217
            HY
Sbjct: 361 KHY 363

Length = 669
>gnl|CDD|206003 pfam13832, zf-HC5HC2H_2, PHD-zinc-finger like domain Back     alignment and domain information
>gnl|CDD|222368 pfam13771, zf-HC5HC2H, PHD-like zinc-binding domain Back     alignment and domain information
>gnl|CDD|222406 pfam13831, PHD_2, PHD-finger Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 237
KOG0956|consensus 900 100.0
KOG0954|consensus 893 100.0
COG5141 669 PHD zinc finger-containing protein [General functi 100.0
KOG0955|consensus 1051 100.0
KOG0957|consensus 707 100.0
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 99.96
PF1377190 zf-HC5HC2H: PHD-like zinc-binding domain 99.74
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 99.29
KOG1080|consensus 1005 99.21
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.07
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.01
KOG1084|consensus375 97.45
KOG1512|consensus381 97.27
KOG1244|consensus336 96.98
KOG4323|consensus 464 96.86
KOG4323|consensus464 96.71
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 96.67
KOG1973|consensus274 95.77
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 95.6
KOG4299|consensus 613 95.47
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 95.0
KOG0825|consensus 1134 93.93
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 92.72
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 92.03
KOG0383|consensus 696 85.88
PF0013053 C1_1: Phorbol esters/diacylglycerol binding domain 82.86
KOG1973|consensus274 82.07
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 81.36
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 80.65
>KOG0956|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.6e-58  Score=435.02  Aligned_cols=197  Identities=73%  Similarity=1.441  Sum_probs=186.9

Q ss_pred             CcccccccccccCCCCCCCCCceecCCCCcccccccccccCcccccCCCCCCCCCCeEEecCCCcCceecccccccccCC
Q psy11049          1 MKEMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQELMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVP   80 (237)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~VC~~~~~~~~n~iv~Cdg~~C~~~VH~~CYGi~~~p   80 (237)
                      |||||||||||+||+||+||||+|||||                                   +|.|+|||.||||..+|
T Consensus         1 MKEMVGGCCVCSDErGWaeNPLVYCDG~-----------------------------------nCsVAVHQaCYGIvqVP   45 (900)
T KOG0956|consen    1 MKEMVGGCCVCSDERGWAENPLVYCDGH-----------------------------------NCSVAVHQACYGIVQVP   45 (900)
T ss_pred             CcccccceeeecCcCCCccCceeeecCC-----------------------------------CceeeeehhcceeEecC
Confidence            9999999999999999999999877754                                   46689999999999999


Q ss_pred             CCeEeeccccccccccccccccCCCCCCCceeecCCchhhhhcccccCCccccCcccCCCCcccccCCCcccceeeecCc
Q psy11049         81 VGSWFCRKCESQEKSTKVRCELCPSKDGALKRTDNNGWAHVVCALYIPEVRFGNVTSMEPILLEEIPPERFNKVCYICEE  160 (237)
Q Consensus        81 ~~~W~C~~C~~~~~~~~~~C~LC~~~~Galk~t~~~~WvHv~Calw~pev~f~~~~~~~~v~i~~i~~~r~~~~C~~C~~  160 (237)
                      +++|||+.|+..++.....|.|||.++||||+|+++.|+||+|||++|||+|.|+..||||.++.|+.+||++.|+||..
T Consensus        46 tGpWfCrKCesqeraarvrCeLCP~kdGALKkTDn~GWAHVVCALYIPEVrFgNV~TMEPIiLq~VP~dRfnKtCYIC~E  125 (900)
T KOG0956|consen   46 TGPWFCRKCESQERAARVRCELCPHKDGALKKTDNGGWAHVVCALYIPEVRFGNVHTMEPIILQDVPHDRFNKTCYICNE  125 (900)
T ss_pred             CCchhhhhhhhhhhhccceeecccCcccceecccCCCceEEEEEeeccceeecccccccceeeccCchhhhcceeeeecc
Confidence            99999999999988889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcCCCcCccceeeecCCCCCCceeehhhhhcCCeeEEecCcccCCcceEecCCccchhhhhhcCCCcccCCCCC
Q psy11049        161 NGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGNYLDNVKYCGYCSHHYSKLVRKKGANIKPIPRDW  235 (237)
Q Consensus       161 ~g~~~~~~~~G~~i~C~~~~C~~~FH~~CA~~~G~~~~~~~~~~~~~~~~~~C~~H~~~~~~~~~~~~k~~~~~~  235 (237)
                      .| +.++...|+|++|...+|.++||++||+.+|++.||.+++.+|++|.-||+.|..|+  |+++++|.++.|+
T Consensus       126 ~G-rpnkA~~GACMtCNKs~CkqaFHVTCAQ~~GLLCEE~gn~~dNVKYCGYCk~HfsKl--kk~~~~k~ipsy~  197 (900)
T KOG0956|consen  126 EG-RPNKAAKGACMTCNKSGCKQAFHVTCAQRAGLLCEEEGNISDNVKYCGYCKYHFSKL--KKSPAIKVIPSYK  197 (900)
T ss_pred             cC-CccccccccceecccccchhhhhhhHhhhhccceeccccccccceechhHHHHHHHh--hcCCCcccCCCCc
Confidence            87 778899999999999999999999999999999999999999999999999999876  6899999998775

>KOG0954|consensus Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG1080|consensus Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1084|consensus Back     alignment and domain information
>KOG1512|consensus Back     alignment and domain information
>KOG1244|consensus Back     alignment and domain information
>KOG4323|consensus Back     alignment and domain information
>KOG4323|consensus Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG1973|consensus Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4299|consensus Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger Back     alignment and domain information
>KOG1973|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
2l43_A88 Structural Basis For Histone Code Recognition By Br 2e-06
2ku3_A71 Solution Structure Of Brd1 Phd1 Finger Length = 71 2e-06
>pdb|2L43|A Chain A, Structural Basis For Histone Code Recognition By Brpf2-Phd1 Finger Length = 88 Back     alignment and structure 
Iteration: 1

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
Query: 43 CCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKC 89
          C +C D      N +++CD   CN+AVHQ CYG+  +P G W CR C
Sbjct: 28 CSICMDGESQNSNVILFCDM--CNLAVHQECYGVPYIPEGQWLCRHC 72
>pdb|2KU3|A Chain A, Solution Structure Of Brd1 Phd1 Finger Length = 71 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 3e-15
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 5e-15
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 2e-09
2yt5_A66 Metal-response element-binding transcription facto 1e-08
1x4i_A70 Inhibitor of growth protein 3; structural genomics 3e-08
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 5e-05
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
 Score = 67.7 bits (165), Expect = 3e-15
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 43  CCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIVTVPVGSWFCRKCESQEKSTKVRCEL 102
           C +C D      N +++CD   CN+AVHQ CYG+  +P G W CR C   +   +   E 
Sbjct: 28  CSICMDGESQNSNVILFCDM--CNLAVHQECYGVPYIPEGQWLCRHCL--QSRARPALEH 83

Query: 103 CP 104
             
Sbjct: 84  HH 85
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query237
2lq6_A87 Bromodomain-containing protein 1; PHD finger, meta 99.58
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.23
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.08
2yt5_A66 Metal-response element-binding transcription facto 98.9
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.9
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.81
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.67
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.58
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.56
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.49
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.47
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.46
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.45
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.45
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.42
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.38
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.34
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.32
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.31
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.28
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.27
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.18
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.13
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.09
2k16_A75 Transcription initiation factor TFIID subunit 3; p 97.94
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 97.93
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 97.87
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 97.85
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 97.78
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 97.76
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 97.74
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 97.71
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 97.7
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 97.69
1weu_A91 Inhibitor of growth family, member 4; structural g 97.69
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 97.57
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.46
1wew_A78 DNA-binding family protein; structural genomics, P 97.16
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.14
1we9_A64 PHD finger family protein; structural genomics, PH 97.13
3o70_A68 PHD finger protein 13; PHF13, structural genomics 97.1
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.05
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 96.89
1wee_A72 PHD finger family protein; structural genomics, PH 96.84
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 96.8
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 96.76
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 96.58
1wem_A76 Death associated transcription factor 1; structura 96.26
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 95.92
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 95.9
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 95.8
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 95.59
1wew_A78 DNA-binding family protein; structural genomics, P 94.32
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 93.6
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 93.21
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 93.15
1we9_A64 PHD finger family protein; structural genomics, PH 92.97
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 92.29
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 92.28
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 92.16
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 91.76
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 91.61
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 91.14
2k16_A75 Transcription initiation factor TFIID subunit 3; p 91.09
1wem_A76 Death associated transcription factor 1; structura 90.62
1weu_A91 Inhibitor of growth family, member 4; structural g 90.3
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 90.04
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 90.0
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 89.98
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 89.58
3o70_A68 PHD finger protein 13; PHF13, structural genomics 89.49
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 89.46
1weq_A85 PHD finger protein 7; structural genomics, PHD dom 89.44
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 89.02
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 88.99
1wee_A72 PHD finger family protein; structural genomics, PH 88.92
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 88.5
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 88.41
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 88.4
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 88.02
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 87.54
3kv5_D 488 JMJC domain-containing histone demethylation prote 87.49
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 87.37
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 86.12
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 85.76
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 83.82
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 83.52
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 81.72
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 81.68
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 81.41
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 81.22
2yt5_A66 Metal-response element-binding transcription facto 81.09
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 80.99
1x4i_A70 Inhibitor of growth protein 3; structural genomics 80.3
1wil_A89 KIAA1045 protein; ring finger domain, structural g 80.1
>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
Probab=99.58  E-value=9e-16  Score=113.29  Aligned_cols=69  Identities=38%  Similarity=0.786  Sum_probs=56.8

Q ss_pred             ccCCCcccceeeecCcCCcCCCcCccceeeecCCCCCCceeehhhhhcCCeeEEecCc-------ccCCcceEecCCccc
Q psy11049        145 EIPPERFNKVCYICEENGHKASRSKFGACMMCNKPGCRQQFHVTCAQTQGLLCEEAGN-------YLDNVKYCGYCSHHY  217 (237)
Q Consensus       145 ~i~~~r~~~~C~~C~~~g~~~~~~~~G~~i~C~~~~C~~~FH~~CA~~~G~~~~~~~~-------~~~~~~~~~~C~~H~  217 (237)
                      +|+++|++++|.+|++++       .|++|+|..++|.++||++||+++|+.++....       ....+.+.+||++|+
T Consensus        10 NIp~~R~~l~C~iC~~~~-------~GAciqC~~~~C~~~fHv~CA~~aGl~~~~~~~~~~~~~~~~~~v~~~~yC~~Hs   82 (87)
T 2lq6_A           10 NIPPARWKLTCYLCKQKG-------VGASIQCHKANCYTAFHVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDVHT   82 (87)
T ss_dssp             CCCCCCCCCCBTTTTBCC-------SSCEEECSCTTTCCEEEHHHHHHHTCCEEEEEEEECTTTSCEEEEEEEECCGGGS
T ss_pred             CCChHHhcCCCcCCCCCC-------CcEeEecCCCCCCCcCcHHHHHHCCCceEeecccccccCCccccceECeECcCCC
Confidence            578899999999999763       499999999999999999999999998864321       112356889999999


Q ss_pred             hhh
Q psy11049        218 SKL  220 (237)
Q Consensus       218 ~~~  220 (237)
                      |..
T Consensus        83 Ppg   85 (87)
T 2lq6_A           83 PPG   85 (87)
T ss_dssp             SSS
T ss_pred             CcC
Confidence            853
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1weq_A PHD finger protein 7; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 237
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 9e-05
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD finger protein 22
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 37.9 bits (87), Expect = 9e-05
 Identities = 18/58 (31%), Positives = 24/58 (41%), Gaps = 8/58 (13%)

Query: 43 CCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGI------VTVPVGSWFCRKCESQEK 94
          C VC   +  + N LV C    C+   HQ C+        V  P   W+C +C  Q K
Sbjct: 19 CVVCRQMTVASGNQLVECQ--ECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTRQMK 74

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query237
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.54
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.47
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.34
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.24
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.23
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 97.98
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 97.92
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 97.6
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.29
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.24
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.12
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 95.16
d1weqa_85 PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculu 94.54
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 94.1
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 92.82
d1wema_76 Death associated transcription factor 1, Datf1 (DI 91.79
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 91.64
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 91.4
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 90.74
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 90.68
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 90.42
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 85.76
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 84.77
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 83.76
d1tbna_66 Protein kinase c-gamma {Rat (Rattus rattus) [TaxId 81.38
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD finger protein 22
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.54  E-value=1.2e-08  Score=72.89  Aligned_cols=52  Identities=31%  Similarity=0.608  Sum_probs=44.2

Q ss_pred             cccCcccccCCCCCCCCCCeEEecCCCcCceecccccccc------cCCCCeEeeccccc
Q psy11049         38 LMLGGCCVCSDDSGWAENPLVYCDGQGCNVAVHQACYGIV------TVPVGSWFCRKCES   91 (237)
Q Consensus        38 ~~~~~C~VC~~~~~~~~n~iv~Cdg~~C~~~VH~~CYGi~------~~p~~~W~C~~C~~   91 (237)
                      ++...|.||......+.+.||+||  +|...||+.|+++.      .+|+..|+|..|..
T Consensus        14 ~~~~~C~iC~~~~~~~~~~~v~Cd--~C~~~~H~~C~~p~~~~~~~~~~~~~W~C~~C~~   71 (88)
T d1weva_          14 EMGLACVVCRQMTVASGNQLVECQ--ECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTR   71 (88)
T ss_dssp             HHCCSCSSSCCCCCCTTCCEEECS--SSCCEEETTTSSSCCCHHHHHCTTCCCCCHHHHH
T ss_pred             cCcCCccCCCCccCCCCCeEEEcC--CCCCccccccCCCcccccccccCCCeEECcccCc
Confidence            455679999988777789999999  69999999999964      35677999999985
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weqa_ g.50.1.2 (A:) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure