Diaphorina citri psyllid: psy11059


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MYFKPISLSSPCDAQRNPCQNGGKCNEDETGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQICTTAPPCLNGATCRPQLTEQLYECVCPPGYKEIRDCTSNPCLNDGVCVWMFDVTIQVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYWELPEIRDCTSNPCLNDGVCVDEVYKGRYWELPEIRDCTSNPCLNDCVNPCQNGGKCNEDETGNYDCTCDALHTGDPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKCFCRPGFAGDHCDVDFDECLSNPCFNGATCQNKINGYTCVCAPGYSGKECSININECESSPCLHGATCIDEVATFSCVCPKGLTGRLCETNIDDCE
cccccccccccccccccccccccEEcccccccEEEEcccccccccccccccccccccccccccccccccccccccccEEccccccccEEEEccccccccccccccccccccEEcccccccccccccccccccccccccccccccccEEcccccccEEEccccccccccccccccEEccccccEEEECcccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccEEcccccccEEEEcccccccccccccEEECccccEEEEcccccccccccccccccccccccccccEEcccccccccccEEEEccccccccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccc
MYFKPISLSSPCDAQRNPCQNGGKCNEDETGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQICTTAPPCLNGATCRPQLTEQLYECVCPPGYKEIRDCTSNPCLNDGVCVWMFDVTIQVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYWELPEIRDCTSNPCLNDGVCVDEVYKGRYWELPEIRDCTSNPCLNDCVNPCQNGGKCNEDETGNYDCTCDALHTGDPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKCFCRPGFAGDHCDVDFDECLSNPCFNGATCQNKINGYTCVCAPGYSGKECSININECESSPCLHGATCIDEVATFSCVCPKGLTGRLCETNIDDC*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYFKPISLSSPCDAQRNPCQNGGKCNEDETGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQICTTAPPCLNGATCRPQLTEQLYECVCPPGYKEIRDCTSNPCLNDGVCVWMFDVTIQVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYWELPEIRDCTSNPCLNDGVCVDEVYKGRYWELPEIRDCTSNPCLNDCVNPCQNGGKCNEDETGNYDCTCDALHTGDPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKCFCRPGFAGDHCDVDFDECLSNPCFNGATCQNKINGYTCVCAPGYSGKECSININECESSPCLHGATCIDEVATFSCVCPKGLTGRLCETNIDDCE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070887 [BP]cellular response to chemical stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0021834 [BP]chemorepulsion involved in embryonic olfactory bulb interneuron precursor migrationprobableGO:0021537, GO:0032502, GO:0044707, GO:0021826, GO:0030154, GO:0048468, GO:0006928, GO:0021988, GO:0051674, GO:0021885, GO:0021889, GO:0007275, GO:0044699, GO:0007417, GO:0051179, GO:0042330, GO:0048869, GO:0021891, GO:0048513, GO:0021879, GO:0030900, GO:0016477, GO:0021872, GO:0021953, GO:0048666, GO:0021831, GO:0006935, GO:0030182, GO:0032501, GO:0009987, GO:0048731, GO:0044767, GO:0008150, GO:0021772, GO:0050919, GO:0042221, GO:0022008, GO:0022028, GO:0022029, GO:0040011, GO:0048699, GO:0007420, GO:0009605, GO:0048870, GO:0050896, GO:0048856, GO:0007399, GO:0021843, GO:0044763
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0048846 [BP]axon extension involved in axon guidanceprobableGO:0048675, GO:0048666, GO:0044707, GO:0048589, GO:0048588, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000902, GO:0000904, GO:0016049, GO:0040007, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0060560, GO:0032502, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0032990, GO:0040011, GO:0048699, GO:0048858, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0008150
GO:0097458 [CC]neuron partprobableGO:0005575, GO:0044464, GO:0005623
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0009967 [BP]positive regulation of signal transductionprobableGO:0009966, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0010243 [BP]response to organic nitrogenprobableGO:0009719, GO:0050896, GO:1901698, GO:0008150, GO:0042221, GO:0010033
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0045597 [BP]positive regulation of cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0045596 [BP]negative regulation of cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:1901700 [BP]response to oxygen-containing compoundprobableGO:0042221, GO:0050896, GO:0008150
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0050767 [BP]regulation of neurogenesisprobableGO:0030154, GO:0007275, GO:0044699, GO:0048869, GO:0060284, GO:0050789, GO:0008150, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0044707, GO:0048856, GO:0051960, GO:2000026, GO:0048731
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0045637 [BP]regulation of myeloid cell differentiationprobableGO:0050793, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:2000026, GO:0051239, GO:0002682, GO:0050789
GO:0008593 [BP]regulation of Notch signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0048585 [BP]negative regulation of response to stimulusprobableGO:0008150, GO:0048519, GO:0065007, GO:0048583, GO:0050789
GO:0032991 [CC]macromolecular complexprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VJ3, chain A
Confidence level:very confident
Coverage over the Query: 290-331,346-426
View the alignment between query and template
View the model in PyMOL
Template: 2VJ3, chain A
Confidence level:very confident
Coverage over the Query: 7-42,55-95,124-158,176-191
View the alignment between query and template
View the model in PyMOL
Template: 2VJ2, chain A
Confidence level:very confident
Coverage over the Query: 37-42,55-158,176-199,237-263
View the alignment between query and template
View the model in PyMOL
Template: 2VJ2, chain A
Confidence level:very confident
Coverage over the Query: 253-333,352-423
View the alignment between query and template
View the model in PyMOL
Template: 4AQS, chain A
Confidence level:confident
Coverage over the Query: 176-264,278-384
View the alignment between query and template
View the model in PyMOL