Psyllid ID: psy11059


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MYFKPISLSSPCDAQRNPCQNGGKCNEDETGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQICTTAPPCLNGATCRPQLTEQLYECVCPPGYKEIRDCTSNPCLNDGVCVWMFDVTIQVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYWELPEIRDCTSNPCLNDGVCVDEVYKGRYWELPEIRDCTSNPCLNDCVNPCQNGGKCNEDETGNYDCTCDALHTGDPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKCFCRPGFAGDHCDVDFDECLSNPCFNGATCQNKINGYTCVCAPGYSGKECSININECESSPCLHGATCIDEVATFSCVCPKGLTGRLCETNIDDCE
cccccccccccccccccccccccEEcccccccEEEEcccccccccccccccccccccccccccccccccccccccccEEccccccccEEEEccccccccccccccccccccEEcccccccccccccccccccccccccccccccccEEcccccccEEEccccccccccccccccEEccccccEEEEEcccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccEEcccccccEEEEcccccccccccccEEEEccccEEEEcccccccccccccccccccccccccccEEcccccccccccEEEEccccccccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccc
cccccccccccccccccccccccEEEccccccEEEEcccccccccccccccccccccccccccccccccccccccccEEEcccccccEEEEccccccccccccccccccccEEEccEEEcccccccccccccccccccccccccccEEccccccEEEEccccccccccccccccEEccccccEEEEccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccEEEccccccEEEEcccccccccccccEEEcccccEEEEcccccccccccccccHcccccccccccEEEccccccccccEEEEccccccccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccc
myfkpislsspcdaqrnpcqnggkcnedetgnydctcdaLHTVCCVglanqtlgsihcetpisnqicttappclngatcrpqlteqlyecvcppgykeirdctsnpclndgvcvwMFDVTIQVYKgrycelpeigdcssnpclndgvcvdvykgrycelpeigdcssnpclndgvcvdvykgrywelpeirdctsnpclndgvcvdevykgrywelpeirdctsnpclndcvnpcqnggkcnedetgnydctcdalhtgdpckhgscvdkragyfcdcpptyggkncsveltgcvgpdtclnggtckpylvdetqhrfnctcpsgyhgkicekcfcrpgfagdhcdvdfdeclsnpcfngatcqnkingytcvcapgysgkecsininecesspclhgatcidevatfscvcpkgltgrlcetniddce
myfkpislsspcdaqrnPCQNGGKCNEDETGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQICTTAPPCLNGATCRPQLTEQLYECVCPPGYKEIRDCTSNPCLNDGVCVWMFDVTIQVYKGRYCELPeigdcssnpclNDGVCVDVYKGRYCELpeigdcssnpclnDGVCVDVYKGRYWELpeirdctsnpclndgVCVDEVYKGRYWELPEIRDCTSNPCLNDCVNPCQNGGKCNEDETGNYDCTCDALHTGDPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKCFCRPGFAGDHCDVDFDECLSNPCFNGATCQNKINGYTCVCAPGYSGKECSININECESSPCLHGATCIDEVATFSCVCPkgltgrlcetniddce
MYFKPISLSSPCDAQRNPCQNGGKCNEDETGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQICTTAPPCLNGATCRPQLTEQLYECVCPPGYKEIRDCTSNPCLNDGVCVWMFDVTIQVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYWELPEIRDCTSNPCLNDGVCVDEVYKGRYWELPEIRDCTSNPCLNDCVNPCQNGGKCNEDETGNYDCTCDALHTGDPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKCFCRPGFAGDHCDVDFDECLSNPCFNGATCQNKINGYTCVCAPGYSGKECSININECESSPCLHGATCIDEVATFSCVCPKGLTGRLCETNIDDCE
*****************************TGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQICTTAPPCLNGATCRPQLTEQLYECVCPPGYKEIRDCTSNPCLNDGVCVWMFDVTIQVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYWELPEIRDCTSNPCLNDGVCVDEVYKGRYWELPEIRDCTSNPCLNDCVNPCQNGGKCNEDETGNYDCTCDALHTGDPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKCFCRPGFAGDHCDVDFDECLSNPCFNGATCQNKINGYTCVCAPGYSGKECSININECESSPCLHGATCIDEVATFSCVCPKGLTGRLCETNI****
MYFKPISLSSPCDAQRNPCQNGGKCNEDETGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQICTTAPPCLNGATCRPQLTEQLYECVCPPGYKEIRDCTSNPCLNDGVCVWMFDVTIQVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYWELPEIRDCTSNPCLNDGVCVDEVYKGRYWELPEIRDCTSNPCLNDCVNPCQNGGKCNEDETGNYDCTCDALHTGDPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKCFCRPGFAGDHCDVDFDECLSNPCFNGATCQNKINGYTCVCAPGYSGKECSININECESSPCLHGATCIDEVATFSCVCPKGLTGRLCETNIDDC*
MYFKPISLSSPCDAQRNPCQNGGKCNEDETGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQICTTAPPCLNGATCRPQLTEQLYECVCPPGYKEIRDCTSNPCLNDGVCVWMFDVTIQVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYWELPEIRDCTSNPCLNDGVCVDEVYKGRYWELPEIRDCTSNPCLNDCVNPCQNGGKCNEDETGNYDCTCDALHTGDPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKCFCRPGFAGDHCDVDFDECLSNPCFNGATCQNKINGYTCVCAPGYSGKECSININECESSPCLHGATCIDEVATFSCVCPKGLTGRLCETNIDDCE
MYFKPISLSSPCDAQRNPCQNGGKCNEDETGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQICTTAPPCLNGATCRPQLTEQLYECVCPPGYKEIRDCTSNPCLNDGVCVWMFDVTIQVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYWELPEIRDCTSNPCLNDGVCVDEVYKGRYWELPEIRDCTSNPCLNDCVNPCQNGGKCNEDETGNYDCTCDALHTGDPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKCFCRPGFAGDHCDVDFDECLSNPCFNGATCQNKINGYTCVCAPGYSGKECSININECESSPCLHGATCIDEVATFSCVCPKGLTGRLCETNI**CE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYFKPISLSSPCDAQRNPCQNGGKCNEDETGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQICTTAPPCLNGATCRPQLTEQLYECVCPPGYKEIRDCTSNPCLNDGVCVWMFDVTIQVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYWELPEIRDCTSNPCLNDGVCVDEVYKGRYWELPEIRDCTSNPCLNDCVNPCQNGGKCNEDETGNYDCTCDALHTGDPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKCFCRPGFAGDHCDVDFDECLSNPCFNGATCQNKINGYTCVCAPGYSGKECSININECESSPCLHGATCIDEVATFSCVCPKGLTGRLCETNIDDCE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query429 2.2.26 [Sep-21-2011]
P10079 1064 Fibropellin-1 OS=Strongyl no N/A 0.878 0.354 0.342 6e-51
Q01705 2531 Neurogenic locus notch ho yes N/A 0.944 0.160 0.314 2e-48
P46530 2437 Neurogenic locus notch ho no N/A 0.944 0.166 0.311 3e-48
Q07008 2531 Neurogenic locus notch ho yes N/A 0.944 0.160 0.314 7e-48
P21783 2524 Neurogenic locus notch pr N/A N/A 0.895 0.152 0.336 2e-47
P10040 2146 Protein crumbs OS=Drosoph yes N/A 0.892 0.178 0.332 5e-47
P46531 2555 Neurogenic locus notch ho yes N/A 0.944 0.158 0.310 7e-47
P07207 2703 Neurogenic locus Notch pr no N/A 0.790 0.125 0.349 1e-46
Q9QW30 2471 Neurogenic locus notch ho no N/A 0.906 0.157 0.337 7e-46
O35516 2470 Neurogenic locus notch ho no N/A 0.909 0.157 0.334 2e-45
>sp|P10079|FBP1_STRPU Fibropellin-1 OS=Strongylocentrotus purpuratus GN=EGF1 PE=1 SV=2 Back     alignment and function desciption
 Score =  202 bits (513), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 167/487 (34%), Positives = 224/487 (45%), Gaps = 110/487 (22%)

Query: 18  PCQNGGKCNEDETGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQICTTAPPCLNGA 77
           PCQNG  C +   G + CTC A +T             + CET I+      + PCLNG 
Sbjct: 450 PCQNGAVCVDGVNG-FVCTCSAGYT------------GVLCETDINE---CASMPCLNGG 493

Query: 78  TCRPQLTEQLYECVCPPGYK------EIRDCTSNPCLNDGVCVWMFD----VTIQVYKGR 127
            C   +    Y C C  G++      +  +C S PC N   C    +      +  Y G 
Sbjct: 494 VCTDLVNG--YICTCAAGFEGTNCETDTDECASFPCQNGATCTDQVNGYVCTCVPGYTGV 551

Query: 128 YCELPEIGDCSSNPCLNDGVCVDVYKGRYCELPE----------IGDCSSNPCLNDGVCV 177
            CE  +I +C+S PCLN G C D   G  C   +            +C+S PCLN G C+
Sbjct: 552 LCET-DINECASFPCLNGGTCNDQVNGYVCVCAQDTSVSTCETDRDECASAPCLNGGACM 610

Query: 178 DVYKGRY------WELP--EIR--DCTSNPCLNDGVCVDEVYKGRYWELP---------E 218
           DV  G        WE    EI   +C S+PC+N G+CVD+V     + LP         E
Sbjct: 611 DVVNGFVCTCLPGWEGTNCEINTDECASSPCMNGGLCVDQVNSYVCFCLPGFTGIHCGTE 670

Query: 219 IRDCTSNPCLNDCVNPCQNGGKCNEDETGNYDCTCDALHTG------------DPCKHGS 266
           I +C S+PCLN        GG+C  D   +Y+C C A +T              PC++G 
Sbjct: 671 IDECASSPCLN--------GGQC-IDRVDSYECVCAAGYTAVRCQINIDECASAPCQNGG 721

Query: 267 -CVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSG 325
            CVD   GY C+C P Y G NC  E+  C     CLNGG C      E  + + C C +G
Sbjct: 722 VCVDGVNGYVCNCAPGYTGDNCETEIDECASM-PCLNGGACI-----EMVNGYTCQCVAG 775

Query: 326 YHGKICEK------------------------CFCRPGFAGDHCDVDFDECLSNPCFNGA 361
           Y G ICE                         C C PGF G +C+ + DEC S+PC NG 
Sbjct: 776 YTGVICETDIDECASAPCQNGGVCTDTINGYICACVPGFTGSNCETNIDECASDPCLNGG 835

Query: 362 TCQNKINGYTCVCAPGYSGKECSININECESSPCLHGATCIDEVATFSCVCPKGLTGRLC 421
            C + +NG+ C C P YSG  C I+++ C S PC +GATC++  A + C C  G  G+ C
Sbjct: 836 ICVDGVNGFVCQCPPNYSGTYCEISLDACRSMPCQNGATCVNVGADYVCECVPGYAGQNC 895

Query: 422 ETNIDDC 428
           E +I++C
Sbjct: 896 EIDINEC 902




Forms the apical lamina, a component of the extracellular matrix.
Strongylocentrotus purpuratus (taxid: 7668)
>sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 Back     alignment and function description
>sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 Back     alignment and function description
>sp|Q07008|NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus GN=Notch1 PE=2 SV=2 Back     alignment and function description
>sp|P21783|NOTCH_XENLA Neurogenic locus notch protein homolog OS=Xenopus laevis GN=notch1 PE=1 SV=3 Back     alignment and function description
>sp|P10040|CRB_DROME Protein crumbs OS=Drosophila melanogaster GN=crb PE=1 SV=3 Back     alignment and function description
>sp|P46531|NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 Back     alignment and function description
>sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 Back     alignment and function description
>sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 Back     alignment and function description
>sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query429
328709397 2180 PREDICTED: protein crumbs-like isoform 3 0.888 0.174 0.377 2e-57
328709399 2180 PREDICTED: protein crumbs-like isoform 4 0.888 0.174 0.377 2e-57
340386674 599 PREDICTED: neurogenic locus notch protei 0.902 0.646 0.359 7e-57
260833680 1668 hypothetical protein BRAFLDRAFT_123361 [ 0.855 0.220 0.371 7e-56
340382857 1067 PREDICTED: neurogenic locus notch homolo 0.902 0.362 0.361 1e-55
270002371 2162 hypothetical protein TcasGA2_TC004424 [T 0.927 0.184 0.315 2e-55
380013994 2055 PREDICTED: LOW QUALITY PROTEIN: protein 0.913 0.190 0.323 2e-55
91076648 2134 PREDICTED: similar to crumbs CG6383-PA [ 0.927 0.186 0.315 2e-55
390335924 1017 PREDICTED: fibropellin-1-like [Strongylo 0.902 0.380 0.367 3e-54
328709395 2304 PREDICTED: protein crumbs-like isoform 2 0.890 0.165 0.345 3e-54
>gi|328709397|ref|XP_003243947.1| PREDICTED: protein crumbs-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  229 bits (585), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 187/496 (37%), Positives = 242/496 (48%), Gaps = 115/496 (23%)

Query: 17  NPCQNGGKCNEDETGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQICTTAPPCLNG 76
           +PCQ+GG C  D   NY C C           +      I+CET I+        PC N 
Sbjct: 321 SPCQHGGVC-IDGVNNYTCAC-----------SKTGYKGINCETNINE---CEINPCSNQ 365

Query: 77  ATCRPQLTEQLYECVCPPGYK------EIRDCTSNPCLNDGVC---VWMFDVTIQV-YKG 126
             C        Y C C  G+       E+ +C SNPC N G C   V  ++    + + G
Sbjct: 366 GICFDNYGS--YTCQCQSGFGGINCDIELNECVSNPCQNGGQCRDQVGTYECRCALGFIG 423

Query: 127 RYCELPEIGDCSSNPCLNDGVCVDVY-------KGRYCELP----EIGDCSSNPCLNDGV 175
           R CE+  + DC S  C  + +CVD         K  Y  +P    EI  CSS+PC N G 
Sbjct: 424 RNCEI-NVDDCESAVCPTNSICVDGVASYSCHCKSGYTGVPPNCSEITVCSSHPCQNGGS 482

Query: 176 CVDV------------YKGRYWELPEIRDCTSNPCLNDGVCVDEV----------YKGRY 213
           C  +            Y G+  ++ +I +C S PCLN G+C D +          Y G Y
Sbjct: 483 CGLLPNGQFNCSCSLGYTGQTCQI-DIDECMSKPCLNGGICHDLINGFRCNCTDNYMGAY 541

Query: 214 WELPEIRDCTSNPCLNDCVNPCQNGGKCNEDETG--NYDCTCDALHTG-------DPCKH 264
            +LP    CT NP      +PC N G C    +   +Y C C     G       D CK 
Sbjct: 542 CQLP-FDACTKNP------SPCLNNGTCLHKTSSLKDYYCKCSPGFEGKNCEGNIDECKT 594

Query: 265 GSC------VDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRF 318
           G+C      +D    Y C+CP  Y G+NCS  L  C   + C N  TC      E    +
Sbjct: 595 GTCPVGKVCIDGINTYECECPEGYTGENCSKILNDCR-DNLCKNNSTCI-----EDVDGY 648

Query: 319 NCTCPSGYHGKICEK-------------------------CFCRPGFAGDHCDVDFDECL 353
            C C SG+ G  C++                         CFCRPGF+GD+CDVDFDECL
Sbjct: 649 TCRCMSGFTGMHCDQDINECEVNKEVCNYGICVNTNGSYQCFCRPGFSGDNCDVDFDECL 708

Query: 354 SNPCFNGATCQNKINGYTCVCAPGYSGKECSININECESSPCLHGATCIDEVATFSCVCP 413
           S PC++GATC+NKING+ C+C PGY+GK CSI+INEC S+PCL+GATCID +A+F+C CP
Sbjct: 709 SQPCYHGATCENKINGFNCICPPGYTGKVCSIDINECSSNPCLNGATCIDNIASFTCSCP 768

Query: 414 KGLTGRLCETNIDDCE 429
            G+ G+LCETNIDDCE
Sbjct: 769 PGIVGKLCETNIDDCE 784




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328709399|ref|XP_003243948.1| PREDICTED: protein crumbs-like isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|340386674|ref|XP_003391833.1| PREDICTED: neurogenic locus notch protein homolog, partial [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|260833680|ref|XP_002611840.1| hypothetical protein BRAFLDRAFT_123361 [Branchiostoma floridae] gi|229297212|gb|EEN67849.1| hypothetical protein BRAFLDRAFT_123361 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|340382857|ref|XP_003389934.1| PREDICTED: neurogenic locus notch homolog protein 1-like [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|270002371|gb|EEZ98818.1| hypothetical protein TcasGA2_TC004424 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380013994|ref|XP_003691029.1| PREDICTED: LOW QUALITY PROTEIN: protein crumbs-like [Apis florea] Back     alignment and taxonomy information
>gi|91076648|ref|XP_970640.1| PREDICTED: similar to crumbs CG6383-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|390335924|ref|XP_001198702.2| PREDICTED: fibropellin-1-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|328709395|ref|XP_003243946.1| PREDICTED: protein crumbs-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query429
UNIPROTKB|P82279 1406 CRB1 "Protein crumbs homolog 1 0.871 0.266 0.336 2.5e-61
UNIPROTKB|F5H0L2 1382 CRB1 "Protein crumbs homolog 1 0.869 0.269 0.337 3e-61
ZFIN|ZDB-GENE-060612-1 1466 crb2a "crumbs homolog 2a" [Dan 0.878 0.257 0.333 2.2e-56
UNIPROTKB|F1M7Y4 2208 Notch1 "Neurogenic locus notch 0.881 0.171 0.334 7.3e-56
ZFIN|ZDB-GENE-060610-1 1458 crb2b "crumbs homolog 2b" [Dan 0.885 0.260 0.315 8.6e-56
FB|FBgn0004647 2703 N "Notch" [Drosophila melanoga 0.906 0.143 0.347 4.3e-55
UNIPROTKB|F6XUN7 1320 CRB1 "Uncharacterized protein" 0.874 0.284 0.321 1e-53
UNIPROTKB|F1Q0H7 1408 CRB1 "Uncharacterized protein" 0.874 0.266 0.321 1.3e-53
ZFIN|ZDB-GENE-990415-183 2465 notch1b "notch homolog 1b" [Da 0.885 0.154 0.339 1.3e-54
FB|FBgn0259685 2146 crb "crumbs" [Drosophila melan 0.892 0.178 0.310 1.8e-54
UNIPROTKB|P82279 CRB1 "Protein crumbs homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 531 (192.0 bits), Expect = 2.5e-61, Sum P(2) = 2.5e-61
 Identities = 153/455 (33%), Positives = 204/455 (44%)

Query:     7 SLSSPCDAQRNPCQNGGKCNEDETGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQI 66
             ++  PC +  NPCQ    C  +  G     C      C  G +    G+I CET I +  
Sbjct:    69 NMKDPCFS--NPCQGSATC-VNTPGERSFLCK-----CPPGYS----GTI-CETTIGS-- 113

Query:    67 CTTAPPCLNGATCRPQLTEQLYE-CVCPPGYK----EIR--DCTSNPCLNDGVCVWMFD- 118
             C     C +G  C     + +Y  C+CP GY     EI   +C S+PC N  VC    D 
Sbjct:   114 CGKNS-CQHGGICHQ---DPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDG 169

Query:   119 ---VTIQVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYCELPEIGDCSSNPCLNDGV 175
                  +  Y+GR+C+L E+ +C+S+PC N+  C++   GRY             C    +
Sbjct:   170 YSCFCVPGYQGRHCDL-EVDECASDPCKNEATCLNEI-GRYT------------C----I 211

Query:   176 CVDVYKGRYWELPEIRDCTSNPCLNDGVCVDEV----------YKGRYWELPEIRDCTSN 225
             C   Y G   EL EI +C S PCLN   C D +          + G + EL    +C S 
Sbjct:   212 CPHNYSGVNCEL-EIDECWSQPCLNGATCQDALGAYFCDCAPGFLGDHCEL-NTDECASQ 269

Query:   226 PCLND--CVNPCQNGGKCNEDETGNYDCTCDALHT---GDPC-KHGSCVDKRAGYFCDCP 279
             PCL+   CV+  +N   CN   +G     C+ L       PC  + +C D    Y C C 
Sbjct:   270 PCLHGGLCVDG-ENRYSCNCTGSGFTGTHCETLMPLCWSKPCHNNATCEDSVDNYTCHCW 328

Query:   280 PTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSG--YHGKICEKCFCR 337
             P Y G  C ++L  C   + C + G C   L  E Q+      PS   YH      C C+
Sbjct:   329 PGYTGAQCEIDLNEC-NSNPCQSNGECVE-LSSEKQYGRITGLPSSFSYHEASGYVCICQ 386

Query:   338 PGFAGDHCDVDFDECLSNPCFNGATCQNKINGYTCVCA------PGYSGKECSININECE 391
             PGF G HC+ D +EC SNPC NG TC+N    YTC C         Y G++CS  +  C 
Sbjct:   387 PGFTGIHCEEDVNECSSNPCQNGGTCENLPGNYTCHCPFDNLSRTFYGGRDCSDILLGCT 446

Query:   392 SSPCLHGATCI----DEVATFSCVCPKGLTGRLCE 422
                CL+  TCI    D    FSC+CP G TG LCE
Sbjct:   447 HQQCLNNGTCIPHFQDGQHGFSCLCPSGYTGSLCE 481


GO:0005509 "calcium ion binding" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0005902 "microvillus" evidence=IEA
GO:0007009 "plasma membrane organization" evidence=IEA
GO:0042462 "eye photoreceptor cell development" evidence=IEA
GO:0005576 "extracellular region" evidence=IEA
GO:0016324 "apical plasma membrane" evidence=IEA
GO:0007163 "establishment or maintenance of cell polarity" evidence=TAS
GO:0007267 "cell-cell signaling" evidence=TAS
UNIPROTKB|F5H0L2 CRB1 "Protein crumbs homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060612-1 crb2a "crumbs homolog 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1M7Y4 Notch1 "Neurogenic locus notch homolog protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060610-1 crb2b "crumbs homolog 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0004647 N "Notch" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F6XUN7 CRB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q0H7 CRB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-183 notch1b "notch homolog 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0259685 crb "crumbs" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query429
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 8e-07
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 1e-05
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 2e-05
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 4e-04
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 0.002
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
 Score = 44.9 bits (107), Expect = 8e-07
 Identities = 21/37 (56%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 348 DFDECLS-NPCFNGATCQNKINGYTCVCAPGYSGKEC 383
           D DEC S NPC NG TC N +  Y C C PGY+G+ C
Sbjct: 1   DIDECASGNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37


Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements. Length = 38

>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 429
KOG4289|consensus 2531 99.76
KOG4289|consensus 2531 99.71
KOG1217|consensus487 99.55
KOG1217|consensus487 99.5
KOG1219|consensus 4289 99.47
KOG1219|consensus4289 99.46
KOG1214|consensus 1289 99.29
KOG0994|consensus 1758 99.26
KOG1214|consensus 1289 99.13
KOG1225|consensus 525 98.96
KOG0994|consensus 1758 98.8
KOG1225|consensus525 98.76
KOG4260|consensus350 98.58
KOG1836|consensus 1705 98.35
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.29
KOG1226|consensus 783 98.17
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.92
KOG4260|consensus350 97.89
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.82
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.81
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.78
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.77
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.7
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.64
KOG1226|consensus783 97.47
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.41
KOG1836|consensus 1705 97.39
cd0005336 EGF Epidermal growth factor domain, found in epide 97.13
smart0018135 EGF Epidermal growth factor-like domain. 97.05
cd0005336 EGF Epidermal growth factor domain, found in epide 96.82
PF1266224 cEGF: Complement Clr-like EGF-like 96.81
smart0018135 EGF Epidermal growth factor-like domain. 96.8
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 96.47
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 96.38
PF1266224 cEGF: Complement Clr-like EGF-like 95.98
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 95.64
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 95.56
KOG3512|consensus 592 95.36
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 95.06
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 94.87
KOG1218|consensus316 94.45
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 93.38
smart0005163 DSL delta serrate ligand. 92.62
KOG3512|consensus 592 92.38
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 92.35
KOG1218|consensus 316 92.02
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 90.86
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 90.56
smart0005163 DSL delta serrate ligand. 90.09
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 89.19
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 89.13
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 88.22
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 85.7
PHA02887126 EGF-like protein; Provisional 84.72
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 84.05
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 83.84
PHA02887126 EGF-like protein; Provisional 82.83
PHA03099139 epidermal growth factor-like protein (EGF-like pro 82.25
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 82.23
KOG3516|consensus 1306 80.46
>KOG4289|consensus Back     alignment and domain information
Probab=99.76  E-value=8.6e-18  Score=175.96  Aligned_cols=115  Identities=30%  Similarity=0.693  Sum_probs=72.5

Q ss_pred             CCCCCCCCCCCCCeeCCccccCCCCCeeeeCCCCccCCCCc---ccccCCCccCC-CCccCCCcCCCCCc-CCCCccccC
Q psy11059        292 TGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICE---KCFCRPGFAGD-HCDVDFDECLSNPC-FNGATCQNK  366 (429)
Q Consensus       292 ~~C~~~~~C~~~~~C~~~~~~~~~~~~~C~C~~G~~G~~C~---~C~C~~g~~g~-~C~~~i~~C~~~~C-~~~~~C~~~  366 (429)
                      +.|.- ++|.+.++|...   +...+|.|.|++||.|..|+   .=.|+.||+|. .|    ..|.-..- .....|..+
T Consensus      1717 ~vC~l-npc~~~g~Cv~s---p~a~GY~C~C~~g~~G~~Ce~~~dq~CPrGWWG~P~C----gpC~CavsKgfdp~CnKt 1788 (2531)
T KOG4289|consen 1717 DVCSL-NPCENQGTCVRS---PGAHGYTCECPPGYTGPYCELRADQPCPRGWWGFPTC----GPCNCAVSKGFDPDCNKT 1788 (2531)
T ss_pred             chhcc-cccccCceeecC---CCCCceeEECCCcccCcchhhhccCCCCCcccCCCCc----cCccccccCCCCCCcccc
Confidence            34544 889999999632   24578999999999999998   34689999985 22    11210000 123456666


Q ss_pred             CCceEEecCCCCCCCCccCCCCCCCCCCCCCCC---EEccCCCCeeeeCCCCCCCCCCCCC
Q psy11059        367 INGYTCVCAPGYSGKECSININECESSPCLHGA---TCIDEVATFSCVCPKGLTGRLCETN  424 (429)
Q Consensus       367 ~g~~~C~C~~G~~G~~C~~~~~~C~~~~C~~~~---~C~~~~~~~~C~C~~g~~G~~C~~~  424 (429)
                      .|  .|.|+..+.-.     +..|.+..|..++   +|.   ...+|.|++|-.|+.|+.-
T Consensus      1789 ~G--~CqCKe~hy~~-----~~~Cl~CdC~~Gs~Sr~C~---adGqC~C~pgaiGRqCdrC 1839 (2531)
T KOG4289|consen 1789 NG--QCQCKENHYRP-----IGSCLPCDCYFGSDSRECD---ADGQCPCKPGAIGRQCDRC 1839 (2531)
T ss_pred             Cc--ceeeccccccC-----CCcceeeccccCCCccccc---CCCcCCCCCcccccccccc
Confidence            55  78888765321     2223433344332   353   4558999999999988753



>KOG4289|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query429
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 4e-22
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 2e-21
4d90_A143 Crystal Structure Of Del-1 Egf Domains Length = 143 2e-14
2ygq_A324 Wif Domain-Epidermal Growth Factor (Egf)-Like Domai 6e-08
3h5c_B 317 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 1e-06
2rqz_A38 Structure Of Sugar Modified Epidermal Growth Factor 4e-05
1edm_B39 Epidermal Growth Factor-Like Domain From Human Fact 6e-05
1edm_B39 Epidermal Growth Factor-Like Domain From Human Fact 7e-04
1x7a_L146 Porcine Factor Ixa Complexed To 1-{3-[amino(Imino) 2e-04
1pfx_L146 Porcine Factor Ixa Length = 146 4e-04
2vj2_A169 Human Jagged-1, Domains Dsl And Egfs1-3 Length = 16 8e-04
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure

Iteration: 1

Score = 102 bits (254), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 44/93 (47%), Positives = 62/93 (66%) Query: 333 KCFCRPGFAGDHCDVDFDECLSNPCFNGATCQNKINGYTCVCAPGYSGKECSININECES 392 +C C G+ G C++D +EC+SNPC N ATC ++I + C+C PGY G C +N +EC S Sbjct: 29 ECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECAS 88 Query: 393 SPCLHGATCIDEVATFSCVCPKGLTGRLCETNI 425 SPCLH C+D++ F C CP G TG LC+ ++ Sbjct: 89 SPCLHNGRCLDKINEFQCECPTGFTGHLCQVDL 121
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|4D90|A Chain A, Crystal Structure Of Del-1 Egf Domains Length = 143 Back     alignment and structure
>pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 Back     alignment and structure
>pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 Back     alignment and structure
>pdb|2RQZ|A Chain A, Structure Of Sugar Modified Epidermal Growth Factor-Like Repeat 12 Of Mouse Notch-1 Receptor Length = 38 Back     alignment and structure
>pdb|1EDM|B Chain B, Epidermal Growth Factor-Like Domain From Human Factor Ix Length = 39 Back     alignment and structure
>pdb|1EDM|B Chain B, Epidermal Growth Factor-Like Domain From Human Factor Ix Length = 39 Back     alignment and structure
>pdb|1X7A|L Chain L, Porcine Factor Ixa Complexed To 1-{3-[amino(Imino) Methyl]phenyl}-N-[4-(1h-Benzimidazol-1-Yl)-2- Fluorophenyl]- 3-(Trifluoromethyl)-1h-Pyrazole-5-Carboxamide Length = 146 Back     alignment and structure
>pdb|1PFX|L Chain L, Porcine Factor Ixa Length = 146 Back     alignment and structure
>pdb|2VJ2|A Chain A, Human Jagged-1, Domains Dsl And Egfs1-3 Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query429
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 7e-36
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 9e-31
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 7e-28
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-12
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-10
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-09
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 3e-09
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 1e-33
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 6e-20
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 1e-11
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 9e-11
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 2e-08
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 2e-07
2vh0_B134 Activated factor XA light chain; serine protease, 2e-26
2vh0_B134 Activated factor XA light chain; serine protease, 3e-23
2vh0_B134 Activated factor XA light chain; serine protease, 3e-18
2vh0_B134 Activated factor XA light chain; serine protease, 7e-15
2vh0_B134 Activated factor XA light chain; serine protease, 3e-08
2vh0_B134 Activated factor XA light chain; serine protease, 1e-07
2vh0_B134 Activated factor XA light chain; serine protease, 7e-06
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 1e-25
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-23
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 1e-06
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-06
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 6e-06
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 1e-05
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-05
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-25
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-24
1nfu_B 195 Coagulation factor XA, light chain; hydrolase; HET 5e-14
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 8e-08
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 3e-06
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-24
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-20
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 7e-10
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 4e-07
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 2e-23
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 4e-19
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 3e-10
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 3e-05
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 9e-04
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-21
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-15
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 1e-10
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 7e-08
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 8e-07
1aut_L114 Activated protein C; serine proteinase, plasma cal 1e-16
1aut_L114 Activated protein C; serine proteinase, plasma cal 2e-16
1aut_L114 Activated protein C; serine proteinase, plasma cal 2e-07
1aut_L114 Activated protein C; serine proteinase, plasma cal 2e-06
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-12
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 8e-07
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 1e-05
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 1e-11
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 2e-10
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 2e-11
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 1e-10
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-11
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 1e-08
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 4e-08
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 7e-07
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 2e-06
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 6e-05
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-11
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 7e-09
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 3e-06
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 3e-05
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-04
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-04
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 5e-04
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 7e-11
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 9e-10
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-07
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-04
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 1e-10
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-09
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 4e-08
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 5e-07
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-09
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 1e-04
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 1e-08
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-04
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 1e-07
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 8e-07
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 9e-07
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 7e-04
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 3e-07
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 5e-05
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-06
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-05
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 9e-06
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 1e-05
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-05
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 7e-05
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 8e-05
3v65_B 386 Low-density lipoprotein receptor-related protein; 2e-04
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 2e-04
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 4e-04
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 6e-04
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
 Score =  127 bits (322), Expect = 7e-36
 Identities = 44/97 (45%), Positives = 62/97 (63%)

Query: 333 KCFCRPGFAGDHCDVDFDECLSNPCFNGATCQNKINGYTCVCAPGYSGKECSININECES 392
           +C C  G+ G  C++D +EC+SNPC N ATC ++I  + C+C PGY G  C +N +EC S
Sbjct: 29  ECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECAS 88

Query: 393 SPCLHGATCIDEVATFSCVCPKGLTGRLCETNIDDCE 429
           SPCLH   C+D++  F C CP G TG LC+ ++    
Sbjct: 89  SPCLHNGRCLDKINEFQCECPTGFTGHLCQVDLHHIL 125


>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query429
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.86
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.86
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.85
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.8
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.77
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.75
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.75
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.72
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.72
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.71
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.7
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.6
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.56
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.56
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.55
2bou_A143 EGF-like module containing mucin-like hormone rece 99.53
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.53
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.51
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.51
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.49
2bou_A143 EGF-like module containing mucin-like hormone rece 99.46
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.44
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.42
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.42
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.36
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.35
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.34
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.34
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.32
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.3
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.26
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.24
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.21
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.21
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.2
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.19
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.18
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.17
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.16
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.16
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.15
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.15
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.14
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.14
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.1
2vh0_B134 Activated factor XA light chain; serine protease, 99.08
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.06
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.05
2vh0_B134 Activated factor XA light chain; serine protease, 99.02
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.01
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.97
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.93
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.93
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.89
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 98.84
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.71
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.63
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.61
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.56
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.54
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.41
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.4
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.39
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.37
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.3
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.28
3v65_B386 Low-density lipoprotein receptor-related protein; 98.28
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.28
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.27
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.27
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.23
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.22
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.2
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.15
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.12
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.09
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.07
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.06
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.0
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.93
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.6
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.57
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.56
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.55
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.52
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.44
1ob1_C99 Major merozoite surface protein; immune system, im 97.4
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.4
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.37
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.35
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 97.27
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.26
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.1
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 96.97
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.84
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 96.76
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 96.73
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.68
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 96.53
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.51
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 96.43
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.4
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 96.37
2y38_A403 Laminin subunit alpha-5; structural protein, cell 96.34
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 96.33
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 96.31
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 96.31
1ob1_C99 Major merozoite surface protein; immune system, im 95.91
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 95.75
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 95.71
2wph_E59 Coagulation factor IXA light chain; serine proteas 95.5
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 95.23
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 95.09
2i9a_A145 Urokinase-type plasminogen activator; growth facto 95.05
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 95.04
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 94.99
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 94.94
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 94.86
2i9a_A145 Urokinase-type plasminogen activator; growth facto 94.85
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 94.78
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 94.54
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 94.47
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 94.47
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 94.47
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 94.46
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 94.43
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 94.29
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 94.26
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 93.75
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 93.54
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 93.38
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 93.09
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 92.65
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 92.3
1szb_A170 Mannose binding lectin-associated serine protease- 92.09
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 91.43
1szb_A170 Mannose binding lectin-associated serine protease- 91.26
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 90.89
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 89.61
2y38_A403 Laminin subunit alpha-5; structural protein, cell 89.21
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 88.03
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 86.56
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 86.44
1b9w_A95 Protein (merozoite surface protein 1); MSP-1, cand 85.09
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 84.07
3fby_A 551 COMP, cartilage oligomeric matrix protein; signatu 83.88
2wph_E59 Coagulation factor IXA light chain; serine proteas 83.47
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
Probab=99.86  E-value=1.7e-26  Score=211.47  Aligned_cols=228  Identities=14%  Similarity=0.081  Sum_probs=176.3

Q ss_pred             CCCCceEEecCCCCcccccccccCcCCCCCCCCCCCCCCCCCCCCCCCCCeEeeCCCCCCeeeeCCCCCc------ccCC
Q psy11059         28 DETGNYDCTCDALHTVCCVGLANQTLGSIHCETPISNQICTTAPPCLNGATCRPQLTEQLYECVCPPGYK------EIRD  101 (429)
Q Consensus        28 ~~~~~~~C~C~~g~~g~~~~~~~~~~~G~~C~~~~~~~~C~~~~~C~~~g~C~~~~~~~~~~C~C~~Gy~------~~~~  101 (429)
                      +..|++++.+.+|..         .+.|.+++..+.  ++.  .+|.++|+|+  +..++|+|.|++||+      ++++
T Consensus         8 n~~Gg~s~~~~pgg~---------~~~g~~~~~n~~--~~~--~~c~ngG~C~--~g~~~y~C~Cp~Gf~G~~Ce~ni~e   72 (267)
T 4fbr_A            8 NQWGGSQATWNPGGL---------WLIGARDKQNVV--ALD--IKSDDGGKTL--KGTMTYNGEGPIGFRGTLSSANNYT   72 (267)
T ss_dssp             EECSSTTSCCEEEEE---------EECCCCSSCCEE--EEE--EECSSTTSEE--EEEEEETTSCCEEEEEEECSTTEEE
T ss_pred             ecCCcccCCcCCCCc---------eeeccccccccc--cCC--CCcCCCCeec--CCCCCeEEeCCCCcccccccccccc
Confidence            677888898988832         122888887765  444  4889999999  999999999999998      5666


Q ss_pred             ------CCCCCCCCCCeEecCCCceeCCeeccCCCCCCCCCCCCCCCCCCCeEeeCCCCccccCCCCCCCCCCCCCCCce
Q psy11059        102 ------CTSNPCLNDGVCVWMFDVTIQVYKGRYCELPEIGDCSSNPCLNDGVCVDVYKGRYCELPEIGDCSSNPCLNDGV  175 (429)
Q Consensus       102 ------C~~~~C~~~g~C~~~~~C~~~g~~G~~C~~~~i~~C~~~~C~~~g~C~~~~~g~~C~~~~~~~C~~~~C~~~~~  175 (429)
                            |.+.||+++++|          |.|.+|+  .+++|.++||.++|+|++...+|.|+                 
T Consensus        73 c~~~~~c~s~pC~nggtc----------~~G~~c~--~~~eC~s~pC~ngG~C~~~~~sy~C~-----------------  123 (267)
T 4fbr_A           73 VENQWGGTSAPWQPGGVW----------VLGARDK--QNIVAVSIKSNDGGKTLTGTTTYNGE-----------------  123 (267)
T ss_dssp             EEEESSSTTSCEEEEEEE----------ECCCCSS--CCEEEEEEECSSTTSEEEEEEEETTS-----------------
T ss_pred             cccccCcCCCcccCCCee----------eccCccc--cccccCCCCCCCCCEEecCCccEEee-----------------
Confidence                  778888888777          5689998  56799999999999999999999999                 


Q ss_pred             ecCCcccCCcccCCCCC------CCCCCCCCCCEEeeCCCCeeeccCCCCCCCCCCCCCCCCCCCCCCCcEeccCCCCCe
Q psy11059        176 CVDVYKGRYWELPEIRD------CTSNPCLNDGVCVDEVYKGRYWELPEIRDCTSNPCLNDCVNPCQNGGKCNEDETGNY  249 (429)
Q Consensus       176 C~~~~~G~~c~~~~~~~------C~~~~C~~~~~C~~~~~~~C~C~~~g~~~C~~~~C~~~~c~~C~~~g~C~~~~~~~~  249 (429)
                      |+.+|+|..|+. ++++      |.+.||.+.++|++....+     ..+ .|..        .+|.++|+| .+...+|
T Consensus       124 C~~Gf~G~~Ce~-~~d~C~n~~~c~s~pC~ngg~c~~G~~c~-----~~i-~c~~--------~~c~ngg~C-~dg~~~y  187 (267)
T 4fbr_A          124 GPIGFKSEVTDG-DTYSVENQWGGSAAPWHSGGVWVLGTRGK-----QNV-INVD--------AKSNDGGKT-LSGTMTY  187 (267)
T ss_dssp             CCEEEEEEECCC-CEEEEEEECSSTTSCCEEEEEEECCSSTT-----SCE-EEEE--------EECSSTTSE-EEEEEEE
T ss_pred             CCCCccccCCCC-CcccccccCCcCCccccCCcceecccccc-----ccc-ccCC--------CCCCCCCEe-eCCCCCe
Confidence            999999999998 8888      6677888888887644222     111 1222        369999999 7788899


Q ss_pred             eEeCCCCCcCCCCCCCc--ccc----------CCCCeeeeCCCCCCCCCCccCCCCCCCCCCCCCCCeeCCccccCCCCC
Q psy11059        250 DCTCDALHTGDPCKHGS--CVD----------KRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHR  317 (429)
Q Consensus       250 ~C~C~~g~~G~~C~~~~--C~~----------~~~~~~C~C~~G~~g~~c~~~~~~C~~~~~C~~~~~C~~~~~~~~~~~  317 (429)
                      +|.|++||+|..|+..+  |.+          ..+.+++.|..++.+..++         .+|.++++|    ++ ...+
T Consensus       188 ~C~Cp~Gf~G~~c~~~i~ec~~~~~c~~~~c~~gG~~~~~C~~g~n~~~c~---------~~c~ngGtC----~d-g~~s  253 (267)
T 4fbr_A          188 NGEGPIGFRGTLTSPDTYTVENQWGGSTAPWNPGGFWMIGARNGQNVVALN---------VASSDGGKT----LA-GTMI  253 (267)
T ss_dssp             TTSCCEEEEEEEEETTEEEEEEECSCTTSCCEEEEEEECCCCTTCCEEEEE---------EECSSTTSE----EE-EEEE
T ss_pred             EEeCCCCccccccccccceeccCCCccCCcccCCCeEEEecCCCCccccCC---------cCCCCCCEe----eC-CCcc
Confidence            99999999999887543  111          1234556677777555442         467889999    55 6678


Q ss_pred             eeeeCCCCccCC
Q psy11059        318 FNCTCPSGYHGK  329 (429)
Q Consensus       318 ~~C~C~~G~~G~  329 (429)
                      |+|.|++||+|+
T Consensus       254 y~CeCp~GF~G~  265 (267)
T 4fbr_A          254 YNGEGPIGFRAR  265 (267)
T ss_dssp             ETTSCCEEEEEE
T ss_pred             eeecCCCCcccc
Confidence            999999999875



>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 429
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 6e-10
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 2e-08
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 2e-09
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 5e-08
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 2e-09
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 6e-09
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 6e-09
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 2e-07
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 3e-08
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 4e-07
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 5e-08
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 2e-06
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 3e-07
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 5e-07
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 5e-07
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 7e-07
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 1e-06
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 3e-06
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 1e-05
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 2e-05
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 0.003
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 2e-05
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 3e-04
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 2e-04
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 0.001
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 4e-04
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 0.001
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 7e-04
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 0.001
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 0.001
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 0.001
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 0.001
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Factor IX (IXa)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 52.0 bits (125), Expect = 6e-10
 Identities = 20/39 (51%), Positives = 26/39 (66%)

Query: 347 VDFDECLSNPCFNGATCQNKINGYTCVCAPGYSGKECSI 385
           VD D+C SNPC NG +C++ IN Y C C  G+ GK C +
Sbjct: 1   VDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCEL 39


>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query429
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 99.07
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.94
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.92
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.88
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.86
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.84
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.83
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.83
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.8
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.76
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.71
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.65
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.65
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.56
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.55
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.55
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.53
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.5
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.44
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.44
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.42
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.32
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.31
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.31
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.27
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.25
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.14
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 98.12
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.04
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.03
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.99
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.87
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.83
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.8
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.7
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.69
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.67
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1nt0a345 Mannose-binding protein associated serine protease 97.65
d1szba245 Mannose-binding protein associated serine protease 97.61
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.59
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.54
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.48
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.44
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.36
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.35
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.35
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.35
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.3
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.26
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.23
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.15
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 96.55
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.48
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 96.45
d3bpse140 Low density lipoprotein (LDL) receptor, different 96.34
d1szba245 Mannose-binding protein associated serine protease 96.3
d1nt0a345 Mannose-binding protein associated serine protease 96.26
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 96.24
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 96.2
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 96.06
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 96.05
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 96.01
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 95.88
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 95.46
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 95.19
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 94.57
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 94.23
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 94.06
d1ijqa250 Low density lipoprotein (LDL) receptor, different 92.97
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 92.93
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 92.91
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 91.79
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 91.19
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 90.92
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 89.96
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 89.54
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 87.76
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 87.21
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 86.67
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 86.0
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 85.96
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 85.74
d1ijqa250 Low density lipoprotein (LDL) receptor, different 84.31
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 84.18
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 83.46
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 83.17
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 80.78
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Neurogenic locus notch homolog protein 1, Notch1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.07  E-value=3.3e-11  Score=76.63  Aligned_cols=41  Identities=32%  Similarity=0.755  Sum_probs=37.9

Q ss_pred             CCCCCCCCCCCCCCCCCEeccCCCCceEEecCCCCcccccccccCcCCCCCCCC
Q psy11059          7 SLSSPCDAQRNPCQNGGKCNEDETGNYDCTCDALHTVCCVGLANQTLGSIHCET   60 (429)
Q Consensus         7 ~~~~~C~~~~~~C~~~g~C~~~~~~~~~C~C~~g~~g~~~~~~~~~~~G~~C~~   60 (429)
                      .++|||+..++||+++|+|+ ++.++|+|.|++||+            |.+|++
T Consensus         1 qDideC~~~~~pC~n~g~C~-n~~g~y~C~C~~G~~------------G~~Ce~   41 (42)
T d2vj3a1           1 QDVDECSLGANPCEHAGKCI-NTLGSFECQCLQGYT------------GPRCEI   41 (42)
T ss_dssp             CCCCTTTSSSCSSSTTCEEE-ECSSSEEEECCTTEE------------STTSCE
T ss_pred             CCCccccCCCCCCCCCcEeE-CCCCCEEeECCCCCc------------CCCCcC
Confidence            37899987789999999999 999999999999999            999975



>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure