Diaphorina citri psyllid: psy11060


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MSTFVDGGIRTLDLLHGKQFSIGTNSVLNVIMLKSDYRLIIRPLYSLCPCAYSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKITTMSFSGGSHIMLNTTREEGYDISFILH
ccccccccccccccccccccccccccccEEEEccccCEEEccccccccccccccccccEEECccccEEEEcccccccccccccccccccccccccccEEcccccccccccEEEEcccccccccccccccccccccccccccCECccccccEEEcc
MSTFVDGGIRTLDLLHGKQFSIGTNSVLNVIMLKSDYRLIIRPLYSLCPCAYSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKITTMSFSGGSHIMLNTTREEGYDISFILH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTFVDGGIRTLDLLHGKQFSIGTNSVLNVIMLKSDYRLIIRPLYSLCPCAYSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKITTMSFSGGSHIMLNTTREEGYDISFILH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein crumbs Plays a central role in cell polarity establishment. Participates in the assembly, positioning and maintenance of adherens junctions via its interaction with the SAC complex. Controls the coalescence of the spots of zonula adherens (ZA) into a adhesive ring around the cells. It may act as a signal. Involved in morphogenesis of the photoreceptor rhabdomere, for positioning and growth of rhabdomere and AJ during the crucial period of photoreceptor extension along the proximodistal axis of the retina.confidentP10040

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035003 [CC]subapical complexprobableGO:0032991, GO:0043296, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005911, GO:0005886, GO:0044425, GO:0044459, GO:0030054
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0030139 [CC]endocytic vesicleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0051234 [BP]establishment of localizationprobableGO:0008150, GO:0051179
GO:0009967 [BP]positive regulation of signal transductionprobableGO:0009966, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0045597 [BP]positive regulation of cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0045596 [BP]negative regulation of cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0016028 [CC]rhabdomereprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0016049 [BP]cell growthprobableGO:0008150, GO:0009987, GO:0044763, GO:0040007, GO:0044699
GO:0045637 [BP]regulation of myeloid cell differentiationprobableGO:0050793, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:2000026, GO:0051239, GO:0002682, GO:0050789
GO:0008593 [BP]regulation of Notch signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0031325 [BP]positive regulation of cellular metabolic processprobableGO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0048699 [BP]generation of neuronsprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0000904 [BP]cell morphogenesis involved in differentiationprobableGO:0032502, GO:0048856, GO:0000902, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009987, GO:0009653, GO:0044699
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0009719 [BP]response to endogenous stimulusprobableGO:0050896, GO:0008150
GO:0007417 [BP]central nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VJ2, chain A
Confidence level:very confident
Coverage over the Query: 36-126
View the alignment between query and template
View the model in PyMOL
Template: 2VJ3, chain A
Confidence level:very confident
Coverage over the Query: 19-128
View the alignment between query and template
View the model in PyMOL
Template: 3QCW, chain A
Confidence level:confident
Coverage over the Query: 80-155
View the alignment between query and template
View the model in PyMOL