Psyllid ID: psy11060

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MSTFVDGGIRTLDLLHGKQFSIGTNSVLNVIMLKSDYRLIIRPLYSLCPCAYSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKITTMSFSGGSHIMLNTTREEGYDISFILH
ccccccccccccccccccccccccccccEEEEccccEEEEccccccccccccccccccEEEEccccEEEEcccccccccccccccccccccccccccEEcccccccccccEEEEcccccccccccccccccccccccccccEEEccccccEEEcc
cccccccccEEEEccccccEEEcccccccEEEEEEccEEEEcccccccccccccccccEEccccccEEEEcccccccccccccccHcccccccccccEEEccccccccccEEEEccccccccccEEEEEEEcccccEEEEEccccccccEEEEEc
mstfvdggirtldllhgkqfsigtNSVLNVIMLKSdyrliirplyslcpcayspckhgscvdkragyfcdcpptyggkncsveltgcvgpdtclnggtckpylvdetqhrfnctcpsgyhgkicekittmsfsggshimlnttreegydiSFILH
mstfvdggIRTLdllhgkqfsigtnSVLNVIMLKSDYRLIIRPLYSLCPCAYSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKITTMSFSGGSHImlnttreegydisfilh
MSTFVDGGIRTLDLLHGKQFSIGTNSVLNVIMLKSDYRLIIRPLYSLCPCAYSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKITTMSFSGGSHIMLNTTREEGYDISFILH
***FVDGGIRTLDLLHGKQFSIGTNSVLNVIMLKSDYRLIIRPLYSLCPCAYSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKITTMSFSGGSHIMLNTTREEGYDISFI**
MSTFVDGGIRTLDLLHGKQFSIGTNSVLNVIMLKSDYRLIIRPLYSLCPCAYSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKITTMSFSGGSHIMLNTTREEGYDISFILH
MSTFVDGGIRTLDLLHGKQFSIGTNSVLNVIMLKSDYRLIIRPLYSLCPCAYSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKITTMSFSGGSHIMLNTTREEGYDISFILH
*STFVDGGIRTLDLLHGKQFSIGTNSVLNVIMLKSDYRLIIRPLYSLCPCAYSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKITTMSFSGGSHIMLNTTREEGYDISFILH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTFVDGGIRTLDLLHGKQFSIGTNSVLNVIMLKSDYRLIIRPLYSLCPCAYSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEKITTMSFSGGSHIMLNTTREEGYDISFILH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query155 2.2.26 [Sep-21-2011]
P10040 2146 Protein crumbs OS=Drosoph yes N/A 0.645 0.046 0.534 3e-24
Q5IJ48 1285 Protein crumbs homolog 2 yes N/A 0.561 0.067 0.477 1e-14
Q80YA8 1282 Protein crumbs homolog 2 yes N/A 0.561 0.067 0.444 1e-12
P82279 1406 Protein crumbs homolog 1 no N/A 0.587 0.064 0.42 2e-12
Q8TDW7 4589 Protocadherin Fat 3 OS=Ho no N/A 0.458 0.015 0.405 6e-11
Q8BNA6 4555 Protocadherin Fat 3 OS=Mu no N/A 0.451 0.015 0.410 3e-10
Q8R508 4555 Protocadherin Fat 3 OS=Ra no N/A 0.451 0.015 0.410 4e-10
Q9NYQ7 3312 Cadherin EGF LAG seven-pa no N/A 0.580 0.027 0.346 5e-10
Q19319 4292 Cadherin-4 OS=Caenorhabdi yes N/A 0.458 0.016 0.367 8e-10
O88278 3313 Cadherin EGF LAG seven-pa no N/A 0.580 0.027 0.336 1e-09
>sp|P10040|CRB_DROME Protein crumbs OS=Drosophila melanogaster GN=crb PE=1 SV=3 Back     alignment and function desciption
 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 67/101 (66%), Gaps = 1/101 (0%)

Query: 52   YSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRF 111
            Y+PC+ G+C D+   Y CDC   YGGKNCSV L GC   + CLNGG C PYL++E  H +
Sbjct: 947  YNPCQRGTCYDQIDDYDCDCDANYGGKNCSVLLKGC-DQNPCLNGGACLPYLINEVTHLY 1005

Query: 112  NCTCPSGYHGKICEKITTMSFSGGSHIMLNTTREEGYDISF 152
            NCTC +G+ G  CEK TT+S    S I + T REEGYDI+ 
Sbjct: 1006 NCTCENGFQGDKCEKTTTLSMVATSLISVTTEREEGYDINL 1046
Plays a central role in cell polarity establishment. Participates in the assembly, positioning and maintenance of adherens junctions via its interaction with the SAC complex. Controls the coalescence of the spots of zonula adherens (ZA) into a adhesive ring around the cells. It may act as a signal. Involved in morphogenesis of the photoreceptor rhabdomere, for positioning and growth of rhabdomere and AJ during the crucial period of photoreceptor extension along the proximodistal axis of the retina.
Drosophila melanogaster (taxid: 7227)
>sp|Q5IJ48|CRUM2_HUMAN Protein crumbs homolog 2 OS=Homo sapiens GN=CRB2 PE=1 SV=2 Back     alignment and function description
>sp|Q80YA8|CRUM2_MOUSE Protein crumbs homolog 2 OS=Mus musculus GN=Crb2 PE=2 SV=3 Back     alignment and function description
>sp|P82279|CRUM1_HUMAN Protein crumbs homolog 1 OS=Homo sapiens GN=CRB1 PE=1 SV=2 Back     alignment and function description
>sp|Q8TDW7|FAT3_HUMAN Protocadherin Fat 3 OS=Homo sapiens GN=FAT3 PE=2 SV=2 Back     alignment and function description
>sp|Q8BNA6|FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus GN=Fat3 PE=1 SV=2 Back     alignment and function description
>sp|Q8R508|FAT3_RAT Protocadherin Fat 3 OS=Rattus norvegicus GN=Fat3 PE=1 SV=1 Back     alignment and function description
>sp|Q9NYQ7|CELR3_HUMAN Cadherin EGF LAG seven-pass G-type receptor 3 OS=Homo sapiens GN=CELSR3 PE=1 SV=2 Back     alignment and function description
>sp|Q19319|CADH4_CAEEL Cadherin-4 OS=Caenorhabditis elegans GN=cdh-4 PE=1 SV=3 Back     alignment and function description
>sp|O88278|CELR3_RAT Cadherin EGF LAG seven-pass G-type receptor 3 OS=Rattus norvegicus GN=Celsr3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
307211378 2241 Protein crumbs [Harpegnathos saltator] 0.645 0.044 0.693 2e-35
328709397 2180 PREDICTED: protein crumbs-like isoform 3 0.645 0.045 0.673 1e-34
328709399 2180 PREDICTED: protein crumbs-like isoform 4 0.645 0.045 0.673 1e-34
328709395 2304 PREDICTED: protein crumbs-like isoform 2 0.645 0.043 0.673 1e-34
328709393 2304 PREDICTED: protein crumbs-like isoform 1 0.645 0.043 0.673 1e-34
307178220 2199 Protein crumbs [Camponotus floridanus] 0.645 0.045 0.683 2e-34
345479876 2147 PREDICTED: protein crumbs-like [Nasonia 0.645 0.046 0.702 3e-34
350411800 2280 PREDICTED: protein crumbs-like [Bombus i 0.645 0.043 0.683 4e-34
340711219 2280 PREDICTED: protein crumbs-like [Bombus t 0.645 0.043 0.683 4e-34
380013994 2055 PREDICTED: LOW QUALITY PROTEIN: protein 0.645 0.048 0.683 4e-34
>gi|307211378|gb|EFN87505.1| Protein crumbs [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 84/101 (83%), Gaps = 1/101 (0%)

Query: 52   YSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRF 111
            Y+PC+HG C D RA YFC C P YGGKNCSVELTGC G + C NGGTC PYLVDET H+F
Sbjct: 1045 YNPCEHGICTDGRADYFCMCEPEYGGKNCSVELTGCQG-NACQNGGTCWPYLVDETIHKF 1103

Query: 112  NCTCPSGYHGKICEKITTMSFSGGSHIMLNTTREEGYDISF 152
            NCTCP+GYHG++C+ +TTMS SG S++++NTTR+EGYDI F
Sbjct: 1104 NCTCPNGYHGEVCDYVTTMSLSGSSYVLVNTTRDEGYDIQF 1144

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328709397|ref|XP_003243947.1| PREDICTED: protein crumbs-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328709399|ref|XP_003243948.1| PREDICTED: protein crumbs-like isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328709395|ref|XP_003243946.1| PREDICTED: protein crumbs-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328709393|ref|XP_001950069.2| PREDICTED: protein crumbs-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307178220|gb|EFN67005.1| Protein crumbs [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345479876|ref|XP_001604138.2| PREDICTED: protein crumbs-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350411800|ref|XP_003489457.1| PREDICTED: protein crumbs-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340711219|ref|XP_003394176.1| PREDICTED: protein crumbs-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380013994|ref|XP_003691029.1| PREDICTED: LOW QUALITY PROTEIN: protein crumbs-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
FB|FBgn0259685 2146 crb "crumbs" [Drosophila melan 0.638 0.046 0.54 6.9e-26
UNIPROTKB|F5H1K8293 CRB1 "Protein crumbs homolog 1 0.587 0.310 0.42 2e-17
UNIPROTKB|Q5IJ48 1285 CRB2 "Protein crumbs homolog 2 0.561 0.067 0.477 4e-17
UNIPROTKB|F6XUN7 1320 CRB1 "Uncharacterized protein" 0.587 0.068 0.41 2.9e-16
UNIPROTKB|F1Q0H7 1408 CRB1 "Uncharacterized protein" 0.587 0.064 0.41 3.2e-16
UNIPROTKB|F1SKU3 1283 CRB2 "Uncharacterized protein" 0.561 0.067 0.455 3.6e-16
ZFIN|ZDB-GENE-060610-1 1458 crb2b "crumbs homolog 2b" [Dan 0.580 0.061 0.404 4.3e-16
UNIPROTKB|F5H0L2 1382 CRB1 "Protein crumbs homolog 1 0.587 0.065 0.42 6.5e-16
UNIPROTKB|P82279 1406 CRB1 "Protein crumbs homolog 1 0.587 0.064 0.42 6.6e-16
UNIPROTKB|F1N3A5 1408 CRB1 "Uncharacterized protein" 0.587 0.064 0.42 1.4e-15
FB|FBgn0259685 crb "crumbs" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 309 (113.8 bits), Expect = 6.9e-26, P = 6.9e-26
 Identities = 54/100 (54%), Positives = 67/100 (67%)

Query:    52 YSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDETQHRF 111
             Y+PC+ G+C D+   Y CDC   YGGKNCSV L GC   + CLNGG C PYL++E  H +
Sbjct:   947 YNPCQRGTCYDQIDDYDCDCDANYGGKNCSVLLKGC-DQNPCLNGGACLPYLINEVTHLY 1005

Query:   112 NCTCPSGYHGKICEKITTMSFSGGSHIMLNTTREEGYDIS 151
             NCTC +G+ G  CEK TT+S    S I + T REEGYDI+
Sbjct:  1006 NCTCENGFQGDKCEKTTTLSMVATSLISVTTEREEGYDIN 1045
GO:0007163 "establishment or maintenance of cell polarity" evidence=NAS;IMP
GO:0005886 "plasma membrane" evidence=ISS;IDA
GO:0016324 "apical plasma membrane" evidence=NAS;IDA;TAS
GO:0045198 "establishment of epithelial cell apical/basal polarity" evidence=TAS
GO:0016021 "integral to membrane" evidence=NAS;TAS
GO:0048477 "oogenesis" evidence=IMP
GO:0002009 "morphogenesis of an epithelium" evidence=NAS;TAS
GO:0045197 "establishment or maintenance of epithelial cell apical/basal polarity" evidence=NAS;TAS
GO:0016334 "establishment or maintenance of polarity of follicular epithelium" evidence=IMP
GO:0042052 "rhabdomere development" evidence=NAS;IMP
GO:0045186 "zonula adherens assembly" evidence=IMP;TAS
GO:0016332 "establishment or maintenance of polarity of embryonic epithelium" evidence=IMP
GO:0016327 "apicolateral plasma membrane" evidence=IDA;IPI
GO:0005913 "cell-cell adherens junction" evidence=NAS
GO:0007043 "cell-cell junction assembly" evidence=NAS
GO:0046664 "dorsal closure, amnioserosa morphology change" evidence=IMP
GO:0045218 "zonula adherens maintenance" evidence=NAS;IMP
GO:0042051 "compound eye photoreceptor development" evidence=IMP;TAS
GO:0045494 "photoreceptor cell maintenance" evidence=NAS;IMP
GO:0016044 "cellular membrane organization" evidence=IMP;TAS
GO:0007435 "salivary gland morphogenesis" evidence=IMP
GO:0035239 "tube morphogenesis" evidence=IMP
GO:0030507 "spectrin binding" evidence=TAS
GO:0035003 "subapical complex" evidence=TAS
GO:0005918 "septate junction" evidence=TAS
GO:0007431 "salivary gland development" evidence=TAS
GO:0008104 "protein localization" evidence=TAS
GO:0001738 "morphogenesis of a polarized epithelium" evidence=TAS
GO:0034332 "adherens junction organization" evidence=IMP
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005080 "protein kinase C binding" evidence=IPI
GO:0045746 "negative regulation of Notch signaling pathway" evidence=IGI
GO:0008284 "positive regulation of cell proliferation" evidence=IMP
GO:0035088 "establishment or maintenance of apical/basal cell polarity" evidence=IMP
GO:0007424 "open tracheal system development" evidence=IMP
GO:0007399 "nervous system development" evidence=IMP
GO:0035090 "maintenance of apical/basal cell polarity" evidence=IMP
GO:0061336 "cell morphogenesis involved in Malpighian tubule morphogenesis" evidence=IMP
GO:0007443 "Malpighian tubule morphogenesis" evidence=IMP
GO:0016028 "rhabdomere" evidence=IDA
GO:0001745 "compound eye morphogenesis" evidence=IGI;IMP
GO:0042327 "positive regulation of phosphorylation" evidence=IMP
GO:0035330 "regulation of hippo signaling cascade" evidence=IGI
GO:0046621 "negative regulation of organ growth" evidence=IMP
GO:0035002 "liquid clearance, open tracheal system" evidence=IGI
UNIPROTKB|F5H1K8 CRB1 "Protein crumbs homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5IJ48 CRB2 "Protein crumbs homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F6XUN7 CRB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q0H7 CRB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKU3 CRB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060610-1 crb2b "crumbs homolog 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F5H0L2 CRB1 "Protein crumbs homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P82279 CRB1 "Protein crumbs homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N3A5 CRB1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P10040CRB_DROMENo assigned EC number0.53460.64510.0465yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 3e-04
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 0.002
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information 
 Score = 36.1 bits (84), Expect = 3e-04
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 5/39 (12%)

Query: 87  CVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICE 125
           C   + C NGGTC       T   + C+CP GY G+ CE
Sbjct: 5   CASGNPCQNGGTCVN-----TVGSYRCSCPPGYTGRNCE 38

Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements. Length = 38
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 155
KOG4289|consensus 2531 99.43
KOG1219|consensus 4289 99.41
KOG1219|consensus 4289 99.28
KOG4289|consensus 2531 98.83
KOG1214|consensus 1289 98.78
KOG1225|consensus 525 98.17
KOG1214|consensus 1289 98.06
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.82
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.81
KOG1225|consensus 525 97.71
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.67
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.55
KOG1217|consensus 487 97.55
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.52
KOG1217|consensus 487 97.35
KOG4260|consensus350 97.25
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.17
cd0005336 EGF Epidermal growth factor domain, found in epide 97.07
PF1266224 cEGF: Complement Clr-like EGF-like 97.04
smart0018135 EGF Epidermal growth factor-like domain. 96.96
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.79
KOG1226|consensus 783 96.69
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 96.54
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 96.46
smart0018135 EGF Epidermal growth factor-like domain. 96.19
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 95.92
cd0005336 EGF Epidermal growth factor domain, found in epide 95.91
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 95.79
PHA03099139 epidermal growth factor-like protein (EGF-like pro 95.73
PHA02887126 EGF-like protein; Provisional 95.62
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 95.14
KOG3514|consensus 1591 94.96
KOG4260|consensus350 94.91
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 94.54
KOG0994|consensus 1758 93.67
smart0005163 DSL delta serrate ligand. 93.4
KOG1226|consensus 783 91.45
KOG0994|consensus 1758 91.34
KOG1836|consensus 1705 87.27
PHA02887126 EGF-like protein; Provisional 87.24
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 87.19
KOG3516|consensus 1306 86.88
PHA03099139 epidermal growth factor-like protein (EGF-like pro 85.19
KOG3512|consensus592 82.71
KOG3516|consensus 1306 82.43
>KOG4289|consensus Back     alignment and domain information 
Probab=99.43  E-value=7.7e-13  Score=112.15  Aligned_cols=119  Identities=31%  Similarity=0.704  Sum_probs=98.3

Q ss_pred             eEEcCCceEEEcCCCCc-------cCCCCCCCCCCC-eeEeCCCCeeeeCCCCCCCCCceecCC--CCCCCCCCCCCCee
Q psy11060         30 VIMLKSDYRLIIRPLYS-------LCPCAYSPCKHG-SCVDKRAGYFCDCPPTYGGKNCSVELT--GCVGPDTCLNGGTC   99 (155)
Q Consensus        30 c~~~~~~~~C~C~~g~~-------~~~C~~~~c~~~-~C~~~~~~~~c~C~~g~~g~~c~~~~~--~C~~~~~c~~~~~C   99 (155)
                      =++..+++.|.|++||+       +|.|.+.||.++ .|....++|+|.|.++|+|..|+.+..  .|.++ .|.++++|
T Consensus      1215 pi~pvnglrCrCPpGFTgd~CeTeiDlCYs~pC~nng~C~srEggYtCeCrpg~tGehCEvs~~agrCvpG-vC~nggtC 1293 (2531)
T KOG4289|consen 1215 PIHPVNGLRCRCPPGFTGDYCETEIDLCYSGPCGNNGRCRSREGGYTCECRPGFTGEHCEVSARAGRCVPG-VCKNGGTC 1293 (2531)
T ss_pred             eccccCceeEeCCCCCCcccccchhHhhhcCCCCCCCceEEecCceeEEecCCccccceeeecccCccccc-eecCCCEE
Confidence            35777899999999998       555667899885 999999999999999999999997653  58888 99999999


Q ss_pred             ecCccCCCCCCeEeeCCCC-CCCCCCCcCcccccCCCceEeecCCCCC-cceEEEEe
Q psy11060        100 KPYLVDETQHRFNCTCPSG-YHGKICEKITTMSFSGGSHIMLNTTREE-GYDISFIL  154 (155)
Q Consensus       100 ~~~~~~~~~~~~~C~C~~g-~~g~~C~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~  154 (155)
                      ..    ...+.+.|.|+.| |++..|+ +...+|.+.+++.+++..++ ..++++.|
T Consensus      1294 ~~----~~nggf~c~Cp~ge~e~prC~-v~trSFp~~sfv~frglrqRfh~Tlslsf 1345 (2531)
T KOG4289|consen 1294 VN----LLNGGFCCHCPYGEFEDPRCE-VTTRSFPPESFVTFRGLRQRFHFTLSLSF 1345 (2531)
T ss_pred             ee----cCCCceeccCCCcccCCCceE-EEeeccCchheEEEeccccceEEEEEEEE
Confidence            83    3447788999988 4578887 67789999999999998655 55666655

>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG3514|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
1o5d_L152 Dissecting And Designing Inhibitor Selectivity Dete 5e-05
1dan_L152 Complex Of Active Site Inhibited Human Blood Coagul 8e-05
1z6j_L142 Crystal Structure Of A Ternary Complex Of Factor Vi 8e-05
1w0y_L142 Tf7a_3771 Complex Length = 142 8e-05
3h5c_B 317 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 1e-04
1dva_L101 Crystal Structure Of The Complex Between The Peptid 1e-04
1qfk_L104 Structure Of Human Factor Viia And Its Implications 2e-04
1j9c_L95 Crystal Structure Of Tissue Factor-Factor Viia Comp 2e-04
2puq_L94 Crystal Structure Of Active Site Inhibited Coagulat 2e-04
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 2e-04
2vj2_A169 Human Jagged-1, Domains Dsl And Egfs1-3 Length = 16 4e-04
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 6e-04
>pdb|1O5D|L Chain L, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 152 Back     alignment and structure 
Iteration: 1

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 37/72 (51%), Gaps = 5/72 (6%)
Query: 50  CAYSPCKHG-SCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLN-GGTCKPYLVDET 107
           CA SPC++G SC D+   Y C C P + G+NC       +    C+N  G C+ Y  D T
Sbjct: 50  CASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQL---ICVNENGGCEQYCSDHT 106
Query: 108 QHRFNCTCPSGY 119
             + +C C  GY
Sbjct: 107 GTKRSCRCHEGY 118
>pdb|1DAN|L Chain L, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 152 Back     alignment and structure
>pdb|1Z6J|L Chain L, Crystal Structure Of A Ternary Complex Of Factor Viia/tissue Factor/pyrazinone Inhibitor Length = 142 Back     alignment and structure
>pdb|1W0Y|L Chain L, Tf7a_3771 Complex Length = 142 Back     alignment and structure
>pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 Back     alignment and structure
>pdb|1DVA|L Chain L, Crystal Structure Of The Complex Between The Peptide Exosite Inhibitor E-76 And Coagulation Factor Viia Length = 101 Back     alignment and structure
>pdb|1QFK|L Chain L, Structure Of Human Factor Viia And Its Implications For The Triggering Of Blood Coagulation Length = 104 Back     alignment and structure
>pdb|1J9C|L Chain L, Crystal Structure Of Tissue Factor-Factor Viia Complex Length = 95 Back     alignment and structure
>pdb|2PUQ|L Chain L, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia In Complex With Soluble Tissue Factor Length = 94 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|2VJ2|A Chain A, Human Jagged-1, Domains Dsl And Egfs1-3 Length = 169 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 4e-16
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-15
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-07
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 3e-15
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-08
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 9e-06
2vh0_B134 Activated factor XA light chain; serine protease, 4e-15
2vh0_B134 Activated factor XA light chain; serine protease, 3e-11
2vh0_B134 Activated factor XA light chain; serine protease, 1e-07
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 6e-15
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 2e-08
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 6e-14
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 1e-13
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 4e-07
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 4e-04
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-13
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-09
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 7e-09
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-05
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-13
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-07
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 8e-07
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 1e-04
1aut_L114 Activated protein C; serine proteinase, plasma cal 1e-11
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 1e-10
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 1e-09
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 5e-09
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 9e-09
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 4e-08
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 4e-08
2ygq_A 324 WIF-1, WNT inhibitory factor 1; signaling protein, 8e-07
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-06
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 2e-06
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 3e-04
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-06
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 6e-04
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 4e-06
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 3e-04
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 4e-04
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 5e-06
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 6e-05
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 3e-04
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 3e-05
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 1e-04
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 5e-04
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 5e-04
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 5e-04
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 7e-04
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
 Score = 69.2 bits (170), Expect = 4e-16
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 7/79 (8%)

Query: 48  CPCAYSPCKH-GSCVDKRAGYFCDCPPTYGGKNCSVELTGCVGPDTCLNGGTCKPYLVDE 106
           C    +PC+H G C++    + C C   Y G  C +++  CV  + C N  TC      +
Sbjct: 8   CSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECV-SNPCQNDATCL-----D 61

Query: 107 TQHRFNCTCPSGYHGKICE 125
               F C C  GY G  CE
Sbjct: 62  QIGEFQCICMPGYEGVHCE 80
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Length = 63 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Length = 53 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.73
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.59
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.46
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.41
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.36
2bou_A143 EGF-like module containing mucin-like hormone rece 99.3
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.28
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.28
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.25
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.15
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.13
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.12
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.12
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.08
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.06
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.04
2vh0_B134 Activated factor XA light chain; serine protease, 99.03
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 99.0
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.99
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.98
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.96
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.91
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.86
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.75
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.75
2bou_A143 EGF-like module containing mucin-like hormone rece 98.72
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.7
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.68
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.66
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.64
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.53
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.49
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.49
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 98.49
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 98.42
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 98.41
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.38
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.37
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.37
4fbr_A 267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.34
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.31
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.31
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 98.31
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.24
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.23
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.23
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.22
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.22
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.16
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.14
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.13
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.1
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.04
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.03
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.02
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.02
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.01
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.0
1aut_L114 Activated protein C; serine proteinase, plasma cal 97.98
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.96
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.93
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.93
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.91
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.89
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.86
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 97.84
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.83
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 97.8
2vh0_B134 Activated factor XA light chain; serine protease, 97.7
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.63
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 97.56
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.56
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.53
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 97.45
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 97.43
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 97.34
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.22
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 97.08
3v65_B 386 Low-density lipoprotein receptor-related protein; 97.06
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 97.05
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 97.02
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 96.96
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.96
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 96.89
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 96.74
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 96.7
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 96.66
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 96.59
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 96.58
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 96.58
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 96.54
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 96.53
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 96.47
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 96.44
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 96.43
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 96.4
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 96.4
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 96.19
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 96.14
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 96.04
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 95.92
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 95.92
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 95.61
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 95.53
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 95.42
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 95.32
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 95.3
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 95.1
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 94.85
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 94.84
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 94.76
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 94.75
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 94.67
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 94.57
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 94.05
1szb_A170 Mannose binding lectin-associated serine protease- 93.98
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 93.94
2i9a_A145 Urokinase-type plasminogen activator; growth facto 93.86
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 93.35
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 93.29
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 92.97
2i9a_A145 Urokinase-type plasminogen activator; growth facto 92.94
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 92.66
1ob1_C99 Major merozoite surface protein; immune system, im 91.89
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 91.64
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 91.61
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 91.49
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 91.35
2wph_E59 Coagulation factor IXA light chain; serine proteas 90.29
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 88.2
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 85.3
1nzi_A159 Complement C1S component; calcium, innate immunity 85.1
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 84.47
1szb_A170 Mannose binding lectin-associated serine protease- 82.44
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 82.37
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 81.92
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
Probab=99.73  E-value=3.9e-17  Score=108.44  Aligned_cols=107  Identities=27%  Similarity=0.749  Sum_probs=88.1

Q ss_pred             CceecCCCcc---eeEEcCCceEEEcCCCCcc-------CCCCCCCCCCC-eeEeCCCCeeeeCCCCCCCCCceecCCCC
Q psy11060         19 QFSIGTNSVL---NVIMLKSDYRLIIRPLYSL-------CPCAYSPCKHG-SCVDKRAGYFCDCPPTYGGKNCSVELTGC   87 (155)
Q Consensus        19 ~~~~~~~~~~---~c~~~~~~~~C~C~~g~~~-------~~C~~~~c~~~-~C~~~~~~~~c~C~~g~~g~~c~~~~~~C   87 (155)
                      .|..+.+++.   .|++..++|.|.|++||.+       ++|...||.++ +|++..+.|.|.|++||.|..|+.++++|
T Consensus         7 eC~~~~~~C~~~g~C~~~~g~~~C~C~~Gy~G~~C~~~~~~C~~~~C~~~~~C~~~~g~~~C~C~~G~~G~~C~~~~~~C   86 (135)
T 2vj3_A            7 ECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDEC   86 (135)
T ss_dssp             TTTSSSCSSSTTCEEEECSSSEEEECCTTEESTTSCEECCTTTTCCCCSSCEEEECSSCEEEECCTTEESSSSCEECCTT
T ss_pred             cccCCCCCCCCCCEeECCCCCEEEECCCCCcCCcccccCccCCCCCCCCCCEEeCCCCCceeeCCCCCcCCcceecCCcc
Confidence            3444444443   5899999999999999984       44556788775 99999999999999999999998888999


Q ss_pred             CCCCCCCCCCeeecCccCCCCCCeEeeCCCCCCCCCCC-cCcccc
Q psy11060         88 VGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICE-KITTMS  131 (155)
Q Consensus        88 ~~~~~c~~~~~C~~~~~~~~~~~~~C~C~~g~~g~~C~-~~~~~~  131 (155)
                      ... +|.+++.|.     +..++|.|.|++||+|..|+ +++++.
T Consensus        87 ~~~-~C~~~g~C~-----~~~g~~~C~C~~G~~G~~C~~~i~~C~  125 (135)
T 2vj3_A           87 ASS-PCLHNGRCL-----DKINEFQCECPTGFTGHLCQVDLHHIL  125 (135)
T ss_dssp             TTC-CSTTTCEEE-----ECSSCEEEECCTTEESSSSCEECC---
T ss_pred             cCC-CcCCCCEeE-----CCCCCeEEECCCCCcCCccCccCcccc
Confidence            888 999999999     67889999999999999997 466664
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 155
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 5e-08
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 2e-06
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 5e-04
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 3e-06
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 9e-04
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 3e-06
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 7e-04
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 5e-06
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 7e-04
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 6e-06
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 0.001
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 2e-05
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 2e-04
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 2e-05
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 4e-05
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 6e-04
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 4e-05
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 0.002
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 5e-05
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 0.001
d1ioxa_50 g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) 3e-04
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 4e-04
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 0.004
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 7e-04
d1moxc_49 g.3.11.1 (C:) Transforming growth factor alpha {Hu 0.001
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 0.001
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 0.002
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 0.002
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 0.003
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Activated protein c (autoprothrombin IIa)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 44.8 bits (106), Expect = 5e-08
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 49 PCAYSPCKHGSCVDKRAGYFCDCPPTYGGKNCSVELT 85
          PCA   C HG+C+D    + CDC   + G+ C  E++
Sbjct: 10 PCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVS 46
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 49 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.84
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.82
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.77
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.76
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.73
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.69
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.68
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.64
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.56
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.55
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.52
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.5
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.46
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.44
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.43
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.42
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.41
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.32
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.31
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.28
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.22
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.22
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.13
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 98.07
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.99
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.96
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.95
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.87
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.7
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.62
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.52
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.5
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.46
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.46
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.46
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.38
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.38
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 97.38
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 97.19
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 97.17
d1nt0a345 Mannose-binding protein associated serine protease 97.05
d1szba245 Mannose-binding protein associated serine protease 97.0
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.99
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.92
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.88
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 96.87
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 96.84
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.8
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.7
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 96.66
d1i0ua241 Low density lipoprotein (LDL) receptor, different 96.58
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.47
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 96.4
d1nt0a345 Mannose-binding protein associated serine protease 96.16
d3bpse140 Low density lipoprotein (LDL) receptor, different 96.1
d1szba245 Mannose-binding protein associated serine protease 96.05
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 95.87
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.86
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 95.73
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 95.72
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 95.7
d3bpse140 Low density lipoprotein (LDL) receptor, different 95.69
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.64
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 95.42
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 95.36
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 94.0
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 93.04
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 92.99
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 92.7
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 92.56
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 91.45
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 90.09
d1ijqa250 Low density lipoprotein (LDL) receptor, different 89.58
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 87.49
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 86.73
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 86.42
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 83.95
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 83.22
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Factor IX (IXa)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.84  E-value=1.9e-09  Score=54.35  Aligned_cols=38  Identities=42%  Similarity=1.046  Sum_probs=34.4

Q ss_pred             cCCCCCCCCCCCCCCeeecCccCCCCCCeEeeCCCCCCCCCCCc
Q psy11060         83 ELTGCVGPDTCLNGGTCKPYLVDETQHRFNCTCPSGYHGKICEK  126 (155)
Q Consensus        83 ~~~~C~~~~~c~~~~~C~~~~~~~~~~~~~C~C~~g~~g~~C~~  126 (155)
                      ++++|.+. ||.++++|+     +..++|.|.|++||+|..|+.
T Consensus         2 d~d~C~~~-PC~ngg~C~-----~~~~~y~C~C~~g~~G~~Cei   39 (39)
T d1edmb_           2 DGDQCESN-PCLNGGSCK-----DDINSYECWCPFGFEGKNCEL   39 (39)
T ss_dssp             CCCTTTTC-CCCTTCEEE-----EETTEEEEECCTTCCSTTSCC
T ss_pred             ccccCCCC-CCCCCcEEE-----cCCCCEEEECCCCCCCCCCCC
Confidence            56889988 999999999     678899999999999999973
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure