Diaphorina citri psyllid: psy11061


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
MVNYTLGESPSRTNHFYMKSVSGEICIAQDLDFESRSSYEFPVVATDRGGLSTTAMVRIQITDVNDNEPIFNPVEYNVSLRDDIQTTTAFAVVLATDRDSDRFGTISYKIVTGKDANLFRIDRSSGELFVTRGNFLSRSNSYHINVSAMDGGGNKCSQDAQVNINIINSHMPIPLFQQSTYSFVVPEDVFKNSIVGTIKAATSDSGKFTEFS
cEEEEEEccccccccEEEEccccEEEEccccccccccCEEEEEEEECcccccEEEEEEEEEEEccccccCECcCEEEEEcccccccccEEEEEEEEEcccccccEEEEEEccccccccEEEEccCEEEEEccccccccccCEEEEEEEECccccccccEEEEEEEEEEcccccccccccCEEEEECcccccccEEEEEEEEEccccccCEcc
MVNYTL*ESPSRTNHFYMKSVSGEICIAQDLDFESRSSYEFPVVATDRGGLSTTAMVRIQITDVNDNEPIFNPVEYNVSLRDDIQTTTAFAVVLATDRDSDRFGTISYKIVTGKDANLFRIDRSSGELFVTRGNFLSRSNSYHINVSAMDGGGNKCSQDAQVNINIINSHMPIPLFQQSTYSFVVPEDVFKNSIVGTIKAATSDS*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNYTLGESPSRTNHFYMKSVSGEICIAQDLDFESRSSYEFPVVATDRGGLSTTAMVRIQITDVNDNEPIFNPVEYNVSLRDDIQTTTAFAVVLATDRDSDRFGTISYKIVTGKDANLFRIDRSSGELFVTRGNFLSRSNSYHINVSAMDGGGNKCSQDAQVNINIINSHMPIPLFQQSTYSFVVPEDVFKNSIVGTIKAATSDSGKFTEFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein dachsous Involved in morphogenesis. May also be involved in cell adhesion.confidentQ24292

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q55, chain A
Confidence level:very confident
Coverage over the Query: 1-211
View the alignment between query and template
View the model in PyMOL