Diaphorina citri psyllid: psy11069


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-
MVTYHHASLHGNQELHTCPARLSPSLACLVSLVGSASALIPRTVCGDILENMFVFCVRHADVLIMPANHVLTVSWVYEEDAITEALQSLGINKEYFISSTGGKNSKKQQLWSCPIVNCNFTSVNLNTFKIHLLKHFDKKPFKCKLTTANNTPCMWGFFSKHKLLRHMTSHDEDKKCYPCDQKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLVCKGCGKQFKVPCRLREHYKAVHESTKNFKCTHDGCKLLFSSKSALKRHNKSKHLNMRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNKIT
ccccccccccccccccccccccccccHHHHHHHHcccccccCECccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccHHHHHccccccccccccccccccccccHHHHHccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccHHHHHHcccccccccc
*VTYHHASLHGNQELHTCPARLSPSLACLVSLVGSASALIPRTVCGDILENMFVFCVRHADVLIMPANHVLTVSWVYEEDAITEALQSLGINKEYFISSTGGKNSKKQQLWSCPIVNCNFTSVNLNTFKIHLLKHFDKKPFKCKLTTANNTPCMWGFFSKHKLLRHMTSHDEDKKCYPCDQKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLVCKGCGKQFKVPCRLREHYKAVHESTKNFKCTHDGCKLLFSSKSALKRHNKSKHLNMRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVH******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTYHHASLHGNQELHTCPARLSPSLACLVSLVGSASALIPRTVCGDILENMFVFCVRHADVLIMPANHVLTVSWVYEEDAITEALQSLGINKEYFISSTGGKNSKKQQLWSCPIVNCNFTSVNLNTFKIHLLKHFDKKPFKCKLTTANNTPCMWGFFSKHKLLRHMTSHDEDKKCYPCDQKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLVCKGCGKQFKVPCRLREHYKAVHESTKNFKCTHDGCKLLFSSKSALKRHNKSKHLNMRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNKIT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0008150 [BP]biological_processprobable
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GLI, chain A
Confidence level:very confident
Coverage over the Query: 178-215,240-355
View the alignment between query and template
View the model in PyMOL
Template: 2GLI, chain A
Confidence level:very confident
Coverage over the Query: 245-386
View the alignment between query and template
View the model in PyMOL
Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 218-384
View the alignment between query and template
View the model in PyMOL
Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 157-235,267-353
View the alignment between query and template
View the model in PyMOL
Template: 2EPA, chain A
Confidence level:very confident
Coverage over the Query: 104-170
View the alignment between query and template
View the model in PyMOL