Diaphorina citri psyllid: psy11092


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MSLVANLFKHILRNHPSTSIRGNSKLNLNSKCICRSISNESNAKDENPPEKCEVLTAKELLENSTTYVGETVETEEDVWASKPYPKHYDPRQSQAQHSLRPKTDPRDTSIIMFPGQGTQFVGMGGDLIKTLPMAKDLFEEASAILKFDLLKLCLEGPASELNKTIHAQAAVFVCSIGALEKLREERPAAIENCVATLGFSLGEITALTFSGVFDYETALELIKIRSQAMQLACEIAPGGMASVMYGPDSQLNLAMKRAKEWCVDRGIPEPELSSISGR
cHHHHHHHHHHHHHccccccccccccccccHHHHHccccccccccccccccHHHccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHcHHHHHHHHHHHHHHccHHHHHHHcccHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccHHHHccccHHHHHHHHHHHHcccccccccccccEEEccc
*****NLFKHIL******************KCIC*************************LL**STTYVGETV************************************SIIMFPGQGTQFVGMGGDLIKTLPMAKDLFEEASAILKFDLLKLCLEGPASELNKTIHAQAAVFVCSIGALEKLREERPAAIENCVATLGFSLGEITALTFSGVFDYETALELIKIRSQAMQLACEIAPGGMASVMYGPDSQLNLAMKRAKEWCVDRGIPEPELSSISGR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLVANLFKHILRNHPSTSIRGNSKLNLNSKCICRSISNESNAKDENPPEKCEVLTAKELLENSTTYVGETVETEEDVWASKPYPKHYDPRQSQAQHSLRPKTDPRDTSIIMFPGQGTQFVGMGGDLIKTLPMAKDLFEEASAILKFDLLKLCLEGPASELNKTIHAQAAVFVCSIGALEKLREERPAAIENCVATLGFSLGEITALTFSGVFDYETALELIKIRSQAMQLACEIAPGGMASVMYGPDSQLNLAMKRAKEWCVDRGIPEPELSSISGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable malonyl-CoA-acyl carrier protein transacylase, mitochondrial Catalyzes the transfer of a malonyl moiety from malonyl-CoA to the free thiol group of the phosphopantetheine arm of the ACP protein. This suggests the existence of the biosynthesis of fatty acids in mitochondrias.confidentQ8T3L6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009536 [CC]plastidprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2C2N, chain A
Confidence level:very confident
Coverage over the Query: 105-278
View the alignment between query and template
View the model in PyMOL
Template: 2HG4, chain A
Confidence level:very confident
Coverage over the Query: 46-278
View the alignment between query and template
View the model in PyMOL