Diaphorina citri psyllid: psy110

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MSPSSVTILFFILSCAQGIYSAVKPVPQPGAPNKVNSTNAKPRDDAFQILQSITANGEGHQSANVKFLETIKNIESANDILTKLILSEKGLDMPASAPLAVPRDFKYVPTWESLDARPLPAWYDEAKVGIFIHWGVFSVPSFRSEWFWKNWENPNSTVTKFMERNYKPGFTYQDFAKDFTAEFFDANHWADILASSGAKYVVLTSKHHEGYTLWPSKYAFSWNSMDIGPKRDLVGELATAIRRKYSDIHFGLYHSLYEWFNPLYVQDKANNFTTNQFVTMKTLPELIEIVQKYQPEVIWSDGEWEAPAEYWKSREFLAWLYNESPVKNTVVVNDRWCNTCLCKHGGYLTCEDKYNPVG
cccccEEHHHHHHHHcccHHccccccccccccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccHHHHHHHHHccccccHHHHHHccccccccHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHcccccccEEEEccccccccccccccccccccccccc
***SSVTILFFILSCAQGIYSAVKPVPQPGAPNKVNSTNAKPRDDAFQILQSIT*******SANVKFLETIKNIESANDILTKLILSEKGLDMPASAPLAVPRDFKYVPTWESLDARPLPAWYDEAKVGIFIHWGVFSVPSFRSEWFWKNWENPNSTVTKFMERNYKPGFTYQDFAKDFTAEFFDANHWADILASSGAKYVVLTSKHHEGYTLWPSKYAFSWNSMDIGPKRDLVGELATAIRRKYSDIHFGLYHSLYEWFNPLYVQDKANNFTTNQFVTMKTLPELIEIVQKYQPEVIWSDGEWEAPAEYWKSREFLAWLYNESPVKNTVVVNDRWCNTCLCKHGGYLTCEDKYN***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPSSVTILFFILSCAQGIYSAVKPVPQPGAPNKVNSTNAKPRDDAFQILQSITANGEGHQSANVKFLETIKNIESANDILTKLILSEKGLDMPASAPLAVPRDFKYVPTWESLDARPLPAWYDEAKVGIFIHWGVFSVPSFRSEWFWKNWENPNSTVTKFMERNYKPGFTYQDFAKDFTAEFFDANHWADILASSGAKYVVLTSKHHEGYTLWPSKYAFSWNSMDIGPKRDLVGELATAIRRKYSDIHFGLYHSLYEWFNPLYVQDKANNFTTNQFVTMKTLPELIEIVQKYQPEVIWSDGEWEAPAEYWKSREFLAWLYNESPVKNTVVVNDRWCNTCLCKHGGYLTCEDKYNPVG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tissue alpha-L-fucosidase Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.confidentP17164
Plasma alpha-L-fucosidase Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.confidentQ5RFI5
Tissue alpha-L-fucosidase Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.confidentP04066

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0042806 [MF]fucose bindingprobableGO:0005488, GO:0003674, GO:0048029, GO:0030246
GO:0033938 [MF]1,6-alpha-L-fucosidase activityprobableGO:0016787, GO:0003824, GO:0016798, GO:0015928, GO:0004560, GO:0003674, GO:0004553
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.2.-.-Glycosylases.probable
3.2.1.-Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.probable
3.2.1.51Alpha-L-fucosidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WVV, chain A
Confidence level:very confident
Coverage over the Query: 105-357
View the alignment between query and template
View the model in PyMOL