Diaphorina citri psyllid: psy11104


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70
MFIYLSKKIAIPNNTKVNCLAWHQNQGWIAVGGDDGLLKVLKLDTVSLTIMIILFQERNLQDKLPPLMLT
cEEEEEEEEEcccccEEEEEEccccccEEEECcccccEEEEEEcccccEEEEEEHHHccccccccccccc
MFIYLSKKIAIPNNTKVNCLAWHQNQGWIAVGGDDGLLKVLKLDTVSLTIMIILFQER***DKLPPLML*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFIYLSKKIAIPNNTKVNCLAWHQNQGWIAVGGDDGLLKVLKLDTVSLTIMIILFQERNLQDKLPPLMLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WD repeat-containing protein 35 May promote CASP3 activation and TNF-stimulated apoptosis. Required for ciliogenesis.confidentQ9P2L0
WD repeat-containing protein 35 May promote CASP3 activation and TNF-stimulated apoptosis. Required for ciliogenesis.confidentA6N6J5
WD repeat-containing protein 35 May promote CASP3 activation and TNF-stimulated apoptosis (By similarity). Required for ciliogenesis.confidentQ8BND3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0030991 [CC]intraflagellar transport particle AprobableGO:0043234, GO:0030990, GO:0032991, GO:0043231, GO:0044463, GO:0044464, GO:0005623, GO:0043226, GO:0005575, GO:0044447, GO:0043229, GO:0044424, GO:0042995, GO:0043227, GO:0005930, GO:0044422, GO:0005622
GO:0031513 [CC]nonmotile primary ciliumprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0005932 [CC]microtubule basal bodyprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0005622, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0042995, GO:0043226, GO:0044422
GO:0035085 [CC]cilium axonemeprobableGO:0005737, GO:0005575, GO:0044463, GO:0043231, GO:0032838, GO:0031514, GO:0044441, GO:0044464, GO:0043229, GO:0005623, GO:0043226, GO:0044446, GO:0044444, GO:0097014, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0005930, GO:0044422, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZ6, chain a
Confidence level:confident
Coverage over the Query: 10-56
View the alignment between query and template
View the model in PyMOL