Psyllid ID: psy11104
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 70 | ||||||
| 118780103 | 1197 | AGAP011562-PA [Anopheles gambiae str. PE | 0.7 | 0.040 | 0.734 | 4e-15 | |
| 242005643 | 1140 | WD-repeat protein, putative [Pediculus h | 0.642 | 0.039 | 0.822 | 7e-15 | |
| 157119878 | 1185 | wd-repeat protein [Aedes aegypti] gi|108 | 0.7 | 0.041 | 0.714 | 2e-14 | |
| 270014596 | 936 | hypothetical protein TcasGA2_TC004637 [T | 0.628 | 0.047 | 0.795 | 2e-13 | |
| 291225001 | 1176 | PREDICTED: WD repeat domain 35-like [Sac | 0.642 | 0.038 | 0.755 | 2e-13 | |
| 156398925 | 1173 | predicted protein [Nematostella vectensi | 0.642 | 0.038 | 0.755 | 2e-13 | |
| 345491192 | 1120 | PREDICTED: WD repeat-containing protein | 0.7 | 0.043 | 0.673 | 3e-13 | |
| 21358427 | 1205 | Oseg4, isoform A [Drosophila melanogaste | 0.671 | 0.039 | 0.702 | 4e-13 | |
| 195490544 | 1205 | GE20921 [Drosophila yakuba] gi|194179284 | 0.671 | 0.039 | 0.702 | 4e-13 | |
| 195336700 | 1198 | GM14175 [Drosophila sechellia] gi|194128 | 0.671 | 0.039 | 0.702 | 4e-13 |
| >gi|118780103|ref|XP_309945.3| AGAP011562-PA [Anopheles gambiae str. PEST] gi|116131270|gb|EAA05707.3| AGAP011562-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Score = 85.5 bits (210), Expect = 4e-15, Method: Composition-based stats.
Identities = 36/49 (73%), Positives = 46/49 (93%)
Query: 1 MFIYLSKKIAIPNNTKVNCLAWHQNQGWIAVGGDDGLLKVLKLDTVSLT 49
MFIYLSKKIAIPNNT++NC+AW+++QG++AVGG+DGLLKVLKL+ S T
Sbjct: 1 MFIYLSKKIAIPNNTRLNCIAWNKDQGYVAVGGEDGLLKVLKLEQASST 49
|
Source: Anopheles gambiae str. PEST Species: Anopheles gambiae Genus: Anopheles Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242005643|ref|XP_002423673.1| WD-repeat protein, putative [Pediculus humanus corporis] gi|212506842|gb|EEB10935.1| WD-repeat protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|157119878|ref|XP_001659551.1| wd-repeat protein [Aedes aegypti] gi|108883135|gb|EAT47360.1| AAEL001513-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|270014596|gb|EFA11044.1| hypothetical protein TcasGA2_TC004637 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|291225001|ref|XP_002732486.1| PREDICTED: WD repeat domain 35-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|156398925|ref|XP_001638438.1| predicted protein [Nematostella vectensis] gi|156225558|gb|EDO46375.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
| >gi|345491192|ref|XP_001607766.2| PREDICTED: WD repeat-containing protein 35-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|21358427|ref|NP_647653.1| Oseg4, isoform A [Drosophila melanogaster] gi|442629527|ref|NP_001261278.1| Oseg4, isoform B [Drosophila melanogaster] gi|7292144|gb|AAF47556.1| Oseg4, isoform A [Drosophila melanogaster] gi|16769404|gb|AAL28921.1| LD29485p [Drosophila melanogaster] gi|220947202|gb|ACL86144.1| Oseg4-PA [synthetic construct] gi|220956734|gb|ACL90910.1| Oseg4-PA [synthetic construct] gi|440215145|gb|AGB93973.1| Oseg4, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195490544|ref|XP_002093183.1| GE20921 [Drosophila yakuba] gi|194179284|gb|EDW92895.1| GE20921 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|195336700|ref|XP_002034971.1| GM14175 [Drosophila sechellia] gi|194128064|gb|EDW50107.1| GM14175 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 70 | ||||||
| FB|FBgn0035264 | 1205 | Oseg4 "Oseg4" [Drosophila mela | 0.428 | 0.024 | 0.7 | 2.6e-07 | |
| ZFIN|ZDB-GENE-060810-148 | 1203 | wdr35 "WD repeat domain 35" [D | 0.428 | 0.024 | 0.7 | 4.4e-06 | |
| RGD|1564116 | 1170 | Wdr35 "WD repeat domain 35" [R | 0.428 | 0.025 | 0.633 | 7e-06 | |
| MGI|MGI:1921932 | 1181 | Wdr35 "WD repeat domain 35" [M | 0.428 | 0.025 | 0.633 | 7.1e-06 | |
| UNIPROTKB|F1SCU2 | 1186 | WDR35 "Uncharacterized protein | 0.428 | 0.025 | 0.633 | 7.1e-06 | |
| UNIPROTKB|Q9P2L0 | 1181 | WDR35 "WD repeat-containing pr | 0.428 | 0.025 | 0.633 | 1.1e-05 | |
| UNIPROTKB|E1BWD7 | 1180 | WDR35 "Uncharacterized protein | 0.428 | 0.025 | 0.566 | 7.5e-05 |
| FB|FBgn0035264 Oseg4 "Oseg4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 128 (50.1 bits), Expect = 2.6e-07, Sum P(2) = 2.6e-07
Identities = 21/30 (70%), Positives = 28/30 (93%)
Query: 1 MFIYLSKKIAIPNNTKVNCLAWHQNQGWIA 30
MF+YLSKKIAIPNN K+NC+AW++ +G+IA
Sbjct: 1 MFVYLSKKIAIPNNVKLNCIAWNKEEGYIA 30
|
|
| ZFIN|ZDB-GENE-060810-148 wdr35 "WD repeat domain 35" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1564116 Wdr35 "WD repeat domain 35" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1921932 Wdr35 "WD repeat domain 35" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SCU2 WDR35 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9P2L0 WDR35 "WD repeat-containing protein 35" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BWD7 WDR35 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 70 | |||
| pfam00400 | 39 | pfam00400, WD40, WD domain, G-beta repeat | 5e-05 | |
| smart00320 | 40 | smart00320, WD40, WD40 repeats | 2e-04 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 6e-04 |
| >gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat | Back alignment and domain information |
|---|
Score = 35.8 bits (83), Expect = 5e-05
Identities = 8/24 (33%), Positives = 14/24 (58%)
Query: 17 VNCLAWHQNQGWIAVGGDDGLLKV 40
V +A+ + +A G DDG ++V
Sbjct: 14 VTSVAFSPDGNLLASGSDDGTVRV 37
|
Length = 39 |
| >gnl|CDD|197651 smart00320, WD40, WD40 repeats | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 70 | |||
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 99.36 | |
| KOG0272|consensus | 459 | 99.05 | ||
| KOG0266|consensus | 456 | 98.96 | ||
| KOG0271|consensus | 480 | 98.8 | ||
| KOG1523|consensus | 361 | 98.71 | ||
| KOG0271|consensus | 480 | 98.67 | ||
| KOG0263|consensus | 707 | 98.67 | ||
| KOG0295|consensus | 406 | 98.66 | ||
| KOG0285|consensus | 460 | 98.64 | ||
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 98.63 | |
| KOG0278|consensus | 334 | 98.62 | ||
| KOG0263|consensus | 707 | 98.61 | ||
| KOG0291|consensus | 893 | 98.6 | ||
| KOG0269|consensus | 839 | 98.58 | ||
| KOG0284|consensus | 464 | 98.57 | ||
| KOG0283|consensus | 712 | 98.55 | ||
| PTZ00421 | 493 | coronin; Provisional | 98.53 | |
| KOG0264|consensus | 422 | 98.52 | ||
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 98.52 | |
| KOG0302|consensus | 440 | 98.51 | ||
| KOG4283|consensus | 397 | 98.5 | ||
| KOG0650|consensus | 733 | 98.5 | ||
| KOG1007|consensus | 370 | 98.49 | ||
| PTZ00421 | 493 | coronin; Provisional | 98.47 | |
| KOG2041|consensus | 1189 | 98.47 | ||
| KOG1310|consensus | 758 | 98.46 | ||
| KOG0291|consensus | 893 | 98.44 | ||
| KOG2096|consensus | 420 | 98.42 | ||
| KOG2394|consensus | 636 | 98.42 | ||
| KOG0272|consensus | 459 | 98.42 | ||
| KOG0266|consensus | 456 | 98.41 | ||
| KOG0318|consensus | 603 | 98.41 | ||
| PTZ00420 | 568 | coronin; Provisional | 98.39 | |
| KOG0279|consensus | 315 | 98.35 | ||
| KOG0645|consensus | 312 | 98.34 | ||
| KOG0315|consensus | 311 | 98.31 | ||
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 98.29 | |
| KOG0302|consensus | 440 | 98.24 | ||
| PTZ00420 | 568 | coronin; Provisional | 98.24 | |
| KOG0292|consensus | 1202 | 98.23 | ||
| KOG0286|consensus | 343 | 98.22 | ||
| KOG0275|consensus | 508 | 98.22 | ||
| KOG0293|consensus | 519 | 98.22 | ||
| KOG0296|consensus | 399 | 98.22 | ||
| KOG0308|consensus | 735 | 98.21 | ||
| KOG0279|consensus | 315 | 98.21 | ||
| KOG0269|consensus | 839 | 98.2 | ||
| KOG0319|consensus | 775 | 98.2 | ||
| KOG1539|consensus | 910 | 98.2 | ||
| KOG0276|consensus | 794 | 98.19 | ||
| KOG0315|consensus | 311 | 98.19 | ||
| KOG0319|consensus | 775 | 98.19 | ||
| KOG0283|consensus | 712 | 98.18 | ||
| KOG0292|consensus | 1202 | 98.15 | ||
| KOG0273|consensus | 524 | 98.15 | ||
| KOG0273|consensus | 524 | 98.14 | ||
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 98.14 | |
| KOG0275|consensus | 508 | 98.13 | ||
| KOG1273|consensus | 405 | 98.13 | ||
| KOG0772|consensus | 641 | 98.13 | ||
| KOG0643|consensus | 327 | 98.09 | ||
| KOG0310|consensus | 487 | 98.09 | ||
| KOG0641|consensus | 350 | 98.08 | ||
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 98.08 | |
| KOG0286|consensus | 343 | 98.06 | ||
| KOG0282|consensus | 503 | 98.06 | ||
| KOG2110|consensus | 391 | 98.05 | ||
| KOG0973|consensus | 942 | 98.04 | ||
| KOG0643|consensus | 327 | 98.02 | ||
| KOG0284|consensus | 464 | 98.01 | ||
| KOG1407|consensus | 313 | 98.0 | ||
| KOG0265|consensus | 338 | 97.99 | ||
| KOG0647|consensus | 347 | 97.98 | ||
| KOG0277|consensus | 311 | 97.98 | ||
| KOG0289|consensus | 506 | 97.98 | ||
| KOG1034|consensus | 385 | 97.98 | ||
| KOG1009|consensus | 434 | 97.96 | ||
| KOG0313|consensus | 423 | 97.96 | ||
| KOG0306|consensus | 888 | 97.96 | ||
| PF12894 | 47 | Apc4_WD40: Anaphase-promoting complex subunit 4 WD | 97.95 | |
| KOG0296|consensus | 399 | 97.94 | ||
| KOG0646|consensus | 476 | 97.92 | ||
| KOG1272|consensus | 545 | 97.92 | ||
| KOG0772|consensus | 641 | 97.91 | ||
| KOG2111|consensus | 346 | 97.89 | ||
| KOG0285|consensus | 460 | 97.87 | ||
| KOG1274|consensus | 933 | 97.87 | ||
| KOG0265|consensus | 338 | 97.86 | ||
| KOG0649|consensus | 325 | 97.85 | ||
| KOG0973|consensus | 942 | 97.85 | ||
| KOG0288|consensus | 459 | 97.85 | ||
| KOG0277|consensus | 311 | 97.85 | ||
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 97.83 | |
| KOG2048|consensus | 691 | 97.8 | ||
| KOG1446|consensus | 311 | 97.8 | ||
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 97.77 | |
| KOG1034|consensus | 385 | 97.77 | ||
| KOG2445|consensus | 361 | 97.76 | ||
| KOG0274|consensus | 537 | 97.76 | ||
| KOG0318|consensus | 603 | 97.75 | ||
| KOG0305|consensus | 484 | 97.75 | ||
| KOG1445|consensus | 1012 | 97.75 | ||
| KOG1036|consensus | 323 | 97.75 | ||
| KOG0645|consensus | 312 | 97.73 | ||
| KOG1408|consensus | 1080 | 97.7 | ||
| KOG0316|consensus | 307 | 97.7 | ||
| KOG0294|consensus | 362 | 97.68 | ||
| KOG0305|consensus | 484 | 97.68 | ||
| KOG0303|consensus | 472 | 97.67 | ||
| KOG0322|consensus | 323 | 97.66 | ||
| KOG0267|consensus | 825 | 97.66 | ||
| KOG1274|consensus | 933 | 97.65 | ||
| KOG2096|consensus | 420 | 97.64 | ||
| KOG1332|consensus | 299 | 97.64 | ||
| KOG4283|consensus | 397 | 97.61 | ||
| KOG1188|consensus | 376 | 97.59 | ||
| KOG1538|consensus | 1081 | 97.58 | ||
| KOG0281|consensus | 499 | 97.57 | ||
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 97.57 | |
| KOG0306|consensus | 888 | 97.56 | ||
| KOG0307|consensus | 1049 | 97.56 | ||
| KOG0270|consensus | 463 | 97.55 | ||
| KOG0276|consensus | 794 | 97.54 | ||
| KOG0289|consensus | 506 | 97.53 | ||
| KOG0640|consensus | 430 | 97.53 | ||
| KOG0267|consensus | 825 | 97.49 | ||
| KOG0274|consensus | 537 | 97.49 | ||
| KOG1009|consensus | 434 | 97.48 | ||
| KOG1446|consensus | 311 | 97.46 | ||
| KOG0281|consensus | 499 | 97.44 | ||
| KOG0264|consensus | 422 | 97.44 | ||
| KOG0316|consensus | 307 | 97.43 | ||
| KOG1334|consensus | 559 | 97.41 | ||
| KOG0268|consensus | 433 | 97.41 | ||
| KOG1407|consensus | 313 | 97.4 | ||
| KOG0282|consensus | 503 | 97.36 | ||
| KOG0293|consensus | 519 | 97.35 | ||
| KOG0295|consensus | 406 | 97.35 | ||
| KOG1524|consensus | 737 | 97.33 | ||
| KOG0290|consensus | 364 | 97.32 | ||
| KOG0640|consensus | 430 | 97.3 | ||
| KOG1332|consensus | 299 | 97.3 | ||
| KOG0299|consensus | 479 | 97.29 | ||
| KOG4328|consensus | 498 | 97.25 | ||
| KOG0294|consensus | 362 | 97.24 | ||
| KOG0268|consensus | 433 | 97.24 | ||
| KOG4227|consensus | 609 | 97.23 | ||
| KOG0647|consensus | 347 | 97.23 | ||
| KOG2919|consensus | 406 | 97.21 | ||
| KOG1063|consensus | 764 | 97.18 | ||
| KOG0642|consensus | 577 | 97.16 | ||
| KOG0974|consensus | 967 | 97.16 | ||
| KOG0301|consensus | 745 | 97.15 | ||
| KOG0771|consensus | 398 | 97.14 | ||
| KOG0310|consensus | 487 | 97.12 | ||
| KOG0308|consensus | 735 | 97.11 | ||
| KOG0278|consensus | 334 | 97.11 | ||
| KOG0303|consensus | 472 | 97.09 | ||
| KOG2445|consensus | 361 | 97.08 | ||
| KOG1524|consensus | 737 | 97.06 | ||
| KOG0313|consensus | 423 | 97.06 | ||
| KOG0300|consensus | 481 | 97.05 | ||
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 97.03 | |
| KOG4640|consensus | 665 | 97.02 | ||
| KOG2394|consensus | 636 | 97.01 | ||
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 96.99 | |
| KOG1445|consensus | 1012 | 96.98 | ||
| KOG3914|consensus | 390 | 96.96 | ||
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 96.93 | |
| KOG0322|consensus | 323 | 96.93 | ||
| KOG2055|consensus | 514 | 96.91 | ||
| KOG0771|consensus | 398 | 96.9 | ||
| KOG2106|consensus | 626 | 96.87 | ||
| KOG1523|consensus | 361 | 96.86 | ||
| KOG0270|consensus | 463 | 96.81 | ||
| KOG0641|consensus | 350 | 96.81 | ||
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 96.78 | |
| KOG1273|consensus | 405 | 96.78 | ||
| KOG1188|consensus | 376 | 96.77 | ||
| KOG1063|consensus | 764 | 96.77 | ||
| KOG1240|consensus | 1431 | 96.76 | ||
| KOG0290|consensus | 364 | 96.72 | ||
| KOG1036|consensus | 323 | 96.71 | ||
| KOG0299|consensus | 479 | 96.7 | ||
| KOG2111|consensus | 346 | 96.67 | ||
| KOG0646|consensus | 476 | 96.66 | ||
| KOG4328|consensus | 498 | 96.61 | ||
| KOG0639|consensus | 705 | 96.54 | ||
| KOG1963|consensus | 792 | 96.53 | ||
| KOG0288|consensus | 459 | 96.45 | ||
| KOG0642|consensus | 577 | 96.43 | ||
| KOG0321|consensus | 720 | 96.39 | ||
| KOG0321|consensus | 720 | 96.36 | ||
| KOG2055|consensus | 514 | 96.29 | ||
| KOG1408|consensus | 1080 | 96.29 | ||
| KOG0300|consensus | 481 | 96.27 | ||
| KOG0644|consensus | 1113 | 96.26 | ||
| KOG0301|consensus | 745 | 96.22 | ||
| KOG0639|consensus | 705 | 96.1 | ||
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 96.08 | |
| KOG1064|consensus | 2439 | 96.08 | ||
| PF10313 | 43 | DUF2415: Uncharacterised protein domain (DUF2415); | 95.99 | |
| KOG2106|consensus | 626 | 95.96 | ||
| KOG3881|consensus | 412 | 95.85 | ||
| KOG1963|consensus | 792 | 95.83 | ||
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 95.81 | |
| KOG1409|consensus | 404 | 95.77 | ||
| KOG0307|consensus | 1049 | 95.7 | ||
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 95.66 | |
| KOG1587|consensus | 555 | 95.51 | ||
| KOG2079|consensus | 1206 | 95.44 | ||
| KOG0280|consensus | 339 | 95.36 | ||
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 95.19 | |
| KOG4532|consensus | 344 | 95.17 | ||
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 95.09 | |
| KOG2315|consensus | 566 | 95.08 | ||
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 95.06 | |
| KOG2048|consensus | 691 | 94.97 | ||
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 94.96 | |
| KOG4714|consensus | 319 | 94.93 | ||
| KOG1310|consensus | 758 | 94.88 | ||
| KOG1007|consensus | 370 | 94.85 | ||
| KOG2321|consensus | 703 | 94.83 | ||
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 94.73 | |
| KOG2110|consensus | 391 | 94.66 | ||
| KOG2139|consensus | 445 | 94.62 | ||
| KOG4378|consensus | 673 | 94.62 | ||
| KOG4378|consensus | 673 | 94.49 | ||
| KOG4227|consensus | 609 | 94.28 | ||
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 94.27 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 94.21 | |
| PF11715 | 547 | Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 | 93.89 | |
| KOG1587|consensus | 555 | 93.82 | ||
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 93.54 | |
| KOG1334|consensus | 559 | 93.52 | ||
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 93.49 | |
| KOG0280|consensus | 339 | 93.47 | ||
| KOG2919|consensus | 406 | 93.38 | ||
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 93.02 | |
| KOG0974|consensus | 967 | 92.58 | ||
| KOG1539|consensus | 910 | 92.56 | ||
| KOG4497|consensus | 447 | 92.45 | ||
| KOG0644|consensus | 1113 | 92.41 | ||
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 92.09 | |
| KOG4547|consensus | 541 | 92.06 | ||
| KOG1517|consensus | 1387 | 91.74 | ||
| KOG2695|consensus | 425 | 91.59 | ||
| KOG3914|consensus | 390 | 91.42 | ||
| KOG2314|consensus | 698 | 91.38 | ||
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 91.32 | |
| PF04841 | 410 | Vps16_N: Vps16, N-terminal region; InterPro: IPR00 | 91.21 | |
| PF07676 | 39 | PD40: WD40-like Beta Propeller Repeat; InterPro: I | 91.15 | |
| KOG2066|consensus | 846 | 91.14 | ||
| KOG0650|consensus | 733 | 91.09 | ||
| KOG3881|consensus | 412 | 91.05 | ||
| KOG1645|consensus | 463 | 91.04 | ||
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 90.91 | |
| KOG4714|consensus | 319 | 90.71 | ||
| KOG2321|consensus | 703 | 90.64 | ||
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 90.54 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 90.43 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 90.37 | |
| COG5170 | 460 | CDC55 Serine/threonine protein phosphatase 2A, reg | 90.12 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 90.09 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 89.96 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 89.44 | |
| PF07569 | 219 | Hira: TUP1-like enhancer of split; InterPro: IPR01 | 89.35 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 89.19 | |
| KOG3621|consensus | 726 | 89.01 | ||
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 88.97 | |
| KOG1354|consensus | 433 | 88.92 | ||
| KOG1240|consensus | 1431 | 88.91 | ||
| KOG4497|consensus | 447 | 88.86 | ||
| COG5170 | 460 | CDC55 Serine/threonine protein phosphatase 2A, reg | 88.81 | |
| KOG3617|consensus | 1416 | 88.74 | ||
| KOG1538|consensus | 1081 | 87.52 | ||
| KOG2066|consensus | 846 | 87.27 | ||
| KOG2695|consensus | 425 | 86.58 | ||
| KOG1409|consensus | 404 | 86.18 | ||
| PF14783 | 111 | BBS2_Mid: Ciliary BBSome complex subunit 2, middle | 86.12 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 86.05 | |
| KOG0649|consensus | 325 | 85.97 | ||
| KOG1354|consensus | 433 | 85.92 | ||
| KOG4190|consensus | 1034 | 85.1 | ||
| KOG1517|consensus | 1387 | 85.08 | ||
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 84.87 | |
| PF04762 | 928 | IKI3: IKI3 family; InterPro: IPR006849 Members of | 84.56 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 84.41 | |
| KOG0309|consensus | 1081 | 82.31 | ||
| PF04762 | 928 | IKI3: IKI3 family; InterPro: IPR006849 Members of | 81.74 | |
| PF07433 | 305 | DUF1513: Protein of unknown function (DUF1513); In | 81.45 | |
| KOG1832|consensus | 1516 | 81.42 | ||
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 81.42 | |
| KOG2315|consensus | 566 | 80.75 | ||
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 80.63 | |
| KOG0309|consensus | 1081 | 80.27 |
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
Probab=99.36 E-value=3.9e-12 Score=64.61 Aligned_cols=39 Identities=21% Similarity=0.457 Sum_probs=35.7
Q ss_pred EeeeeeecCCCCCeEEEEEcCCCCEEEEEeCCCcEEEEE
Q psy11104 4 YLSKKIAIPNNTKVNCLAWHQNQGWIAVGGDDGLLKVLK 42 (70)
Q Consensus 4 ~~~~~I~~~~~~~V~~va~spdg~~LasGg~Dg~IklWd 42 (70)
|...+...+|.+.|++|+|+|++.+|||||.|++|++||
T Consensus 1 g~~~~~~~~h~~~i~~i~~~~~~~~~~s~~~D~~i~vwd 39 (39)
T PF00400_consen 1 GKCVRTFRGHSSSINSIAWSPDGNFLASGSSDGTIRVWD 39 (39)
T ss_dssp EEEEEEEESSSSSEEEEEEETTSSEEEEEETTSEEEEEE
T ss_pred CeEEEEEcCCCCcEEEEEEecccccceeeCCCCEEEEEC
Confidence 455667789999999999999999999999999999997
|
WD40 repeats usually assume a 7-8 bladed beta-propeller fold, but proteins have been found with 4 to 16 repeated units, which also form a circularised beta-propeller structure. WD-repeat proteins are a large family found in all eukaryotes and are implicated in a variety of functions ranging from signal transduction and transcription regulation to cell cycle control and apoptosis. Repeated WD40 motifs act as a site for protein-protein interaction, and proteins containing WD40 repeats are known to serve as platforms for the assembly of protein complexes or mediators of transient interplay among other proteins. The specificity of the proteins is determined by the sequences outside the repeats themselves. Examples of such complexes are G proteins (beta subunit is a beta-propeller), TAFII transcription factor, and E3 ubiquitin ligase [, ]. In Arabidopsis spp., several WD40-containing proteins act as key regulators of plant-specific developmental events.; PDB: 2ZKQ_a 3CFV_B 3CFS_B 1PEV_A 1NR0_A 1VYH_T 3RFH_A 3O2Z_T 3FRX_C 3U5G_g .... |
| >KOG0272|consensus | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >KOG0271|consensus | Back alignment and domain information |
|---|
| >KOG1523|consensus | Back alignment and domain information |
|---|
| >KOG0271|consensus | Back alignment and domain information |
|---|
| >KOG0263|consensus | Back alignment and domain information |
|---|
| >KOG0295|consensus | Back alignment and domain information |
|---|
| >KOG0285|consensus | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG0278|consensus | Back alignment and domain information |
|---|
| >KOG0263|consensus | Back alignment and domain information |
|---|
| >KOG0291|consensus | Back alignment and domain information |
|---|
| >KOG0269|consensus | Back alignment and domain information |
|---|
| >KOG0284|consensus | Back alignment and domain information |
|---|
| >KOG0283|consensus | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0264|consensus | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0302|consensus | Back alignment and domain information |
|---|
| >KOG4283|consensus | Back alignment and domain information |
|---|
| >KOG0650|consensus | Back alignment and domain information |
|---|
| >KOG1007|consensus | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG2041|consensus | Back alignment and domain information |
|---|
| >KOG1310|consensus | Back alignment and domain information |
|---|
| >KOG0291|consensus | Back alignment and domain information |
|---|
| >KOG2096|consensus | Back alignment and domain information |
|---|
| >KOG2394|consensus | Back alignment and domain information |
|---|
| >KOG0272|consensus | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >KOG0318|consensus | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0279|consensus | Back alignment and domain information |
|---|
| >KOG0645|consensus | Back alignment and domain information |
|---|
| >KOG0315|consensus | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0302|consensus | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0292|consensus | Back alignment and domain information |
|---|
| >KOG0286|consensus | Back alignment and domain information |
|---|
| >KOG0275|consensus | Back alignment and domain information |
|---|
| >KOG0293|consensus | Back alignment and domain information |
|---|
| >KOG0296|consensus | Back alignment and domain information |
|---|
| >KOG0308|consensus | Back alignment and domain information |
|---|
| >KOG0279|consensus | Back alignment and domain information |
|---|
| >KOG0269|consensus | Back alignment and domain information |
|---|
| >KOG0319|consensus | Back alignment and domain information |
|---|
| >KOG1539|consensus | Back alignment and domain information |
|---|
| >KOG0276|consensus | Back alignment and domain information |
|---|
| >KOG0315|consensus | Back alignment and domain information |
|---|
| >KOG0319|consensus | Back alignment and domain information |
|---|
| >KOG0283|consensus | Back alignment and domain information |
|---|
| >KOG0292|consensus | Back alignment and domain information |
|---|
| >KOG0273|consensus | Back alignment and domain information |
|---|
| >KOG0273|consensus | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0275|consensus | Back alignment and domain information |
|---|
| >KOG1273|consensus | Back alignment and domain information |
|---|
| >KOG0772|consensus | Back alignment and domain information |
|---|
| >KOG0643|consensus | Back alignment and domain information |
|---|
| >KOG0310|consensus | Back alignment and domain information |
|---|
| >KOG0641|consensus | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0286|consensus | Back alignment and domain information |
|---|
| >KOG0282|consensus | Back alignment and domain information |
|---|
| >KOG2110|consensus | Back alignment and domain information |
|---|
| >KOG0973|consensus | Back alignment and domain information |
|---|
| >KOG0643|consensus | Back alignment and domain information |
|---|
| >KOG0284|consensus | Back alignment and domain information |
|---|
| >KOG1407|consensus | Back alignment and domain information |
|---|
| >KOG0265|consensus | Back alignment and domain information |
|---|
| >KOG0647|consensus | Back alignment and domain information |
|---|
| >KOG0277|consensus | Back alignment and domain information |
|---|
| >KOG0289|consensus | Back alignment and domain information |
|---|
| >KOG1034|consensus | Back alignment and domain information |
|---|
| >KOG1009|consensus | Back alignment and domain information |
|---|
| >KOG0313|consensus | Back alignment and domain information |
|---|
| >KOG0306|consensus | Back alignment and domain information |
|---|
| >PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain | Back alignment and domain information |
|---|
| >KOG0296|consensus | Back alignment and domain information |
|---|
| >KOG0646|consensus | Back alignment and domain information |
|---|
| >KOG1272|consensus | Back alignment and domain information |
|---|
| >KOG0772|consensus | Back alignment and domain information |
|---|
| >KOG2111|consensus | Back alignment and domain information |
|---|
| >KOG0285|consensus | Back alignment and domain information |
|---|
| >KOG1274|consensus | Back alignment and domain information |
|---|
| >KOG0265|consensus | Back alignment and domain information |
|---|
| >KOG0649|consensus | Back alignment and domain information |
|---|
| >KOG0973|consensus | Back alignment and domain information |
|---|
| >KOG0288|consensus | Back alignment and domain information |
|---|
| >KOG0277|consensus | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG2048|consensus | Back alignment and domain information |
|---|
| >KOG1446|consensus | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG1034|consensus | Back alignment and domain information |
|---|
| >KOG2445|consensus | Back alignment and domain information |
|---|
| >KOG0274|consensus | Back alignment and domain information |
|---|
| >KOG0318|consensus | Back alignment and domain information |
|---|
| >KOG0305|consensus | Back alignment and domain information |
|---|
| >KOG1445|consensus | Back alignment and domain information |
|---|
| >KOG1036|consensus | Back alignment and domain information |
|---|
| >KOG0645|consensus | Back alignment and domain information |
|---|
| >KOG1408|consensus | Back alignment and domain information |
|---|
| >KOG0316|consensus | Back alignment and domain information |
|---|
| >KOG0294|consensus | Back alignment and domain information |
|---|
| >KOG0305|consensus | Back alignment and domain information |
|---|
| >KOG0303|consensus | Back alignment and domain information |
|---|
| >KOG0322|consensus | Back alignment and domain information |
|---|
| >KOG0267|consensus | Back alignment and domain information |
|---|
| >KOG1274|consensus | Back alignment and domain information |
|---|
| >KOG2096|consensus | Back alignment and domain information |
|---|
| >KOG1332|consensus | Back alignment and domain information |
|---|
| >KOG4283|consensus | Back alignment and domain information |
|---|
| >KOG1188|consensus | Back alignment and domain information |
|---|
| >KOG1538|consensus | Back alignment and domain information |
|---|
| >KOG0281|consensus | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0306|consensus | Back alignment and domain information |
|---|
| >KOG0307|consensus | Back alignment and domain information |
|---|
| >KOG0270|consensus | Back alignment and domain information |
|---|
| >KOG0276|consensus | Back alignment and domain information |
|---|
| >KOG0289|consensus | Back alignment and domain information |
|---|
| >KOG0640|consensus | Back alignment and domain information |
|---|
| >KOG0267|consensus | Back alignment and domain information |
|---|
| >KOG0274|consensus | Back alignment and domain information |
|---|
| >KOG1009|consensus | Back alignment and domain information |
|---|
| >KOG1446|consensus | Back alignment and domain information |
|---|
| >KOG0281|consensus | Back alignment and domain information |
|---|
| >KOG0264|consensus | Back alignment and domain information |
|---|
| >KOG0316|consensus | Back alignment and domain information |
|---|
| >KOG1334|consensus | Back alignment and domain information |
|---|
| >KOG0268|consensus | Back alignment and domain information |
|---|
| >KOG1407|consensus | Back alignment and domain information |
|---|
| >KOG0282|consensus | Back alignment and domain information |
|---|
| >KOG0293|consensus | Back alignment and domain information |
|---|
| >KOG0295|consensus | Back alignment and domain information |
|---|
| >KOG1524|consensus | Back alignment and domain information |
|---|
| >KOG0290|consensus | Back alignment and domain information |
|---|
| >KOG0640|consensus | Back alignment and domain information |
|---|
| >KOG1332|consensus | Back alignment and domain information |
|---|
| >KOG0299|consensus | Back alignment and domain information |
|---|
| >KOG4328|consensus | Back alignment and domain information |
|---|
| >KOG0294|consensus | Back alignment and domain information |
|---|
| >KOG0268|consensus | Back alignment and domain information |
|---|
| >KOG4227|consensus | Back alignment and domain information |
|---|
| >KOG0647|consensus | Back alignment and domain information |
|---|
| >KOG2919|consensus | Back alignment and domain information |
|---|
| >KOG1063|consensus | Back alignment and domain information |
|---|
| >KOG0642|consensus | Back alignment and domain information |
|---|
| >KOG0974|consensus | Back alignment and domain information |
|---|
| >KOG0301|consensus | Back alignment and domain information |
|---|
| >KOG0771|consensus | Back alignment and domain information |
|---|
| >KOG0310|consensus | Back alignment and domain information |
|---|
| >KOG0308|consensus | Back alignment and domain information |
|---|
| >KOG0278|consensus | Back alignment and domain information |
|---|
| >KOG0303|consensus | Back alignment and domain information |
|---|
| >KOG2445|consensus | Back alignment and domain information |
|---|
| >KOG1524|consensus | Back alignment and domain information |
|---|
| >KOG0313|consensus | Back alignment and domain information |
|---|
| >KOG0300|consensus | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4640|consensus | Back alignment and domain information |
|---|
| >KOG2394|consensus | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1445|consensus | Back alignment and domain information |
|---|
| >KOG3914|consensus | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG0322|consensus | Back alignment and domain information |
|---|
| >KOG2055|consensus | Back alignment and domain information |
|---|
| >KOG0771|consensus | Back alignment and domain information |
|---|
| >KOG2106|consensus | Back alignment and domain information |
|---|
| >KOG1523|consensus | Back alignment and domain information |
|---|
| >KOG0270|consensus | Back alignment and domain information |
|---|
| >KOG0641|consensus | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >KOG1273|consensus | Back alignment and domain information |
|---|
| >KOG1188|consensus | Back alignment and domain information |
|---|
| >KOG1063|consensus | Back alignment and domain information |
|---|
| >KOG1240|consensus | Back alignment and domain information |
|---|
| >KOG0290|consensus | Back alignment and domain information |
|---|
| >KOG1036|consensus | Back alignment and domain information |
|---|
| >KOG0299|consensus | Back alignment and domain information |
|---|
| >KOG2111|consensus | Back alignment and domain information |
|---|
| >KOG0646|consensus | Back alignment and domain information |
|---|
| >KOG4328|consensus | Back alignment and domain information |
|---|
| >KOG0639|consensus | Back alignment and domain information |
|---|
| >KOG1963|consensus | Back alignment and domain information |
|---|
| >KOG0288|consensus | Back alignment and domain information |
|---|
| >KOG0642|consensus | Back alignment and domain information |
|---|
| >KOG0321|consensus | Back alignment and domain information |
|---|
| >KOG0321|consensus | Back alignment and domain information |
|---|
| >KOG2055|consensus | Back alignment and domain information |
|---|
| >KOG1408|consensus | Back alignment and domain information |
|---|
| >KOG0300|consensus | Back alignment and domain information |
|---|
| >KOG0644|consensus | Back alignment and domain information |
|---|
| >KOG0301|consensus | Back alignment and domain information |
|---|
| >KOG0639|consensus | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1064|consensus | Back alignment and domain information |
|---|
| >PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins | Back alignment and domain information |
|---|
| >KOG2106|consensus | Back alignment and domain information |
|---|
| >KOG3881|consensus | Back alignment and domain information |
|---|
| >KOG1963|consensus | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1409|consensus | Back alignment and domain information |
|---|
| >KOG0307|consensus | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >KOG1587|consensus | Back alignment and domain information |
|---|
| >KOG2079|consensus | Back alignment and domain information |
|---|
| >KOG0280|consensus | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >KOG4532|consensus | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2315|consensus | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >KOG2048|consensus | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >KOG4714|consensus | Back alignment and domain information |
|---|
| >KOG1310|consensus | Back alignment and domain information |
|---|
| >KOG1007|consensus | Back alignment and domain information |
|---|
| >KOG2321|consensus | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >KOG2110|consensus | Back alignment and domain information |
|---|
| >KOG2139|consensus | Back alignment and domain information |
|---|
| >KOG4378|consensus | Back alignment and domain information |
|---|
| >KOG4378|consensus | Back alignment and domain information |
|---|
| >KOG4227|consensus | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates | Back alignment and domain information |
|---|
| >KOG1587|consensus | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1334|consensus | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >KOG0280|consensus | Back alignment and domain information |
|---|
| >KOG2919|consensus | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0974|consensus | Back alignment and domain information |
|---|
| >KOG1539|consensus | Back alignment and domain information |
|---|
| >KOG4497|consensus | Back alignment and domain information |
|---|
| >KOG0644|consensus | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4547|consensus | Back alignment and domain information |
|---|
| >KOG1517|consensus | Back alignment and domain information |
|---|
| >KOG2695|consensus | Back alignment and domain information |
|---|
| >KOG3914|consensus | Back alignment and domain information |
|---|
| >KOG2314|consensus | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG2066|consensus | Back alignment and domain information |
|---|
| >KOG0650|consensus | Back alignment and domain information |
|---|
| >KOG3881|consensus | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4714|consensus | Back alignment and domain information |
|---|
| >KOG2321|consensus | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG3621|consensus | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1354|consensus | Back alignment and domain information |
|---|
| >KOG1240|consensus | Back alignment and domain information |
|---|
| >KOG4497|consensus | Back alignment and domain information |
|---|
| >COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3617|consensus | Back alignment and domain information |
|---|
| >KOG1538|consensus | Back alignment and domain information |
|---|
| >KOG2066|consensus | Back alignment and domain information |
|---|
| >KOG2695|consensus | Back alignment and domain information |
|---|
| >KOG1409|consensus | Back alignment and domain information |
|---|
| >PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >KOG0649|consensus | Back alignment and domain information |
|---|
| >KOG1354|consensus | Back alignment and domain information |
|---|
| >KOG4190|consensus | Back alignment and domain information |
|---|
| >KOG1517|consensus | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0309|consensus | Back alignment and domain information |
|---|
| >PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] | Back alignment and domain information |
|---|
| >PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG1832|consensus | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2315|consensus | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >KOG0309|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 70 | |||
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 5e-05 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 2e-04 |
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 | Back alignment and structure |
|---|
Score = 38.3 bits (88), Expect = 5e-05
Identities = 7/36 (19%), Positives = 12/36 (33%), Gaps = 3/36 (8%)
Query: 12 PNNTKVNCLAWHQNQ---GWIAVGGDDGLLKVLKLD 44
+ + C W++ A GLL + L
Sbjct: 481 AHGINITCTKWNETSAGGKCYAFSNSAGLLTLEYLS 516
|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 70 | |||
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 99.11 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 99.07 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 99.07 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 99.06 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 99.05 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 99.05 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 99.04 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 99.04 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 99.03 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 99.01 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 99.01 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 99.0 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 99.0 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 99.0 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 99.0 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 98.96 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 98.94 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 98.93 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 98.92 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 98.91 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 98.91 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 98.91 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 98.9 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 98.9 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 98.88 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 98.88 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 98.88 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 98.85 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 98.85 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 98.84 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 98.83 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 98.83 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 98.83 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 98.83 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 98.82 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 98.82 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 98.81 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 98.8 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 98.79 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 98.79 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 98.79 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 98.79 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 98.79 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 98.78 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 98.78 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 98.78 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 98.77 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 98.77 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 98.75 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 98.75 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 98.75 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 98.75 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 98.73 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 98.72 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 98.71 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 98.71 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 98.7 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 98.7 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 98.68 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 98.68 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 98.68 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 98.67 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 98.67 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 98.67 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 98.66 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 98.66 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 98.66 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 98.65 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 98.64 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 98.63 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 98.63 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 98.63 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 98.63 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 98.63 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 98.62 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 98.62 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 98.61 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 98.6 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 98.59 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 98.59 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 98.59 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 98.59 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 98.59 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 98.58 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 98.58 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 98.58 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 98.58 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 98.57 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 98.56 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 98.56 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 98.54 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 98.54 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 98.53 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 98.53 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 98.53 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 98.51 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 98.51 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 98.51 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 98.51 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 98.5 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 98.5 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 98.47 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 98.46 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 98.44 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 98.44 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 98.43 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 98.42 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 98.42 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 98.42 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 98.42 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 98.41 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 98.4 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 98.39 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 98.39 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 98.38 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 98.38 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 98.34 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 98.27 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 98.23 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 98.18 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 98.03 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 98.03 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 98.0 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.94 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 97.91 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.89 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 97.86 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 97.77 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 97.66 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 97.64 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 97.56 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 97.54 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 97.49 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 97.47 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 97.43 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 97.4 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 97.38 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 97.38 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 97.34 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 97.25 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 97.13 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 97.03 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 96.99 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 96.98 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 96.93 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 96.93 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 96.9 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 96.9 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 96.87 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 96.87 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 96.86 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 96.85 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 96.75 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 96.68 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 96.65 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 96.65 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 96.6 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 96.58 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 96.55 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 96.55 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 96.54 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 96.4 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 96.32 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 96.29 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 96.27 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 96.22 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 96.16 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 96.14 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 96.08 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 96.07 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 95.98 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 95.97 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 95.91 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 95.86 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 95.86 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 95.73 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 95.57 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 95.57 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 95.44 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 95.44 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 95.37 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 95.37 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 95.02 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 94.88 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 94.84 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 94.72 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 94.62 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 94.37 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 94.37 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 94.07 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 94.05 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 93.53 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 93.24 | |
| 4gq2_M | 950 | Nucleoporin NUP120; beta propeller alpha helical, | 92.81 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 92.4 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 91.93 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 91.91 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 91.9 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 91.56 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 91.32 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 91.24 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 91.19 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 91.11 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 91.09 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 90.83 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 90.73 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 89.71 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 89.6 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 89.54 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 88.61 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 88.53 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 88.05 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 87.81 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 87.8 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 87.71 | |
| 3pbp_A | 452 | Nucleoporin NUP82; beta-propeller, mRNA export, mR | 87.05 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 86.63 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 86.28 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 86.23 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 86.13 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 86.02 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 85.82 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 85.77 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 85.15 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 83.48 | |
| 3f7f_A | 729 | Nucleoporin NUP120; nuclear pore complex, macromol | 83.12 | |
| 1yiq_A | 689 | Quinohemoprotein alcohol dehydrogenase; electron t | 82.7 | |
| 1kb0_A | 677 | Quinohemoprotein alcohol dehydrogenase; beta-prope | 82.06 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 81.97 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 81.85 | |
| 2hz6_A | 369 | Endoplasmic reticulum to nucleus signalling 1 isof | 80.59 |
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
Probab=99.11 E-value=1.5e-10 Score=79.80 Aligned_cols=40 Identities=8% Similarity=0.111 Sum_probs=35.5
Q ss_pred eeecCCCCCeEEEEEcCCCCEEEEEeCCCcEEEEECCCCC
Q psy11104 8 KIAIPNNTKVNCLAWHQNQGWIAVGGDDGLLKVLKLDTVS 47 (70)
Q Consensus 8 ~I~~~~~~~V~~va~spdg~~LasGg~Dg~IklWdi~~~~ 47 (70)
.+...|.+.|++|+|||||++|||||.|++|||||+....
T Consensus 306 ~~~~gH~~~V~~v~fSpdg~~laS~S~D~tvrvw~ip~~~ 345 (365)
T 4h5i_A 306 IFKQAHSFAITEVTISPDSTYVASVSAANTIHIIKLPLNY 345 (365)
T ss_dssp EETTSSSSCEEEEEECTTSCEEEEEETTSEEEEEECCTTT
T ss_pred EecCcccCCEEEEEECCCCCEEEEEeCCCeEEEEEcCCCC
Confidence 3456899999999999999999999999999999986543
|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A | Back alignment and structure |
|---|
| >1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 70 | ||||
| d1k8kc_ | 371 | b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 | 2e-04 | |
| d1yfqa_ | 342 | b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake | 3e-04 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 4e-04 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 7e-04 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 0.001 | |
| d1gxra_ | 337 | b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum | 0.001 | |
| d1nr0a2 | 299 | b.69.4.1 (A:313-611) Actin interacting protein 1 { | 0.002 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 0.004 |
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: Arp2/3 complex 41 kDa subunit ARPC1 species: Cow (Bos taurus) [TaxId: 9913]
Score = 35.6 bits (80), Expect = 2e-04
Identities = 6/38 (15%), Positives = 19/38 (50%)
Query: 17 VNCLAWHQNQGWIAVGGDDGLLKVLKLDTVSLTIMIIL 54
++C AW++++ IA+ ++ + + + + L
Sbjct: 10 ISCHAWNKDRTQIAICPNNHEVHIYEKSGNKWVQVHEL 47
|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 70 | |||
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 99.34 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.32 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.26 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 99.24 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 99.18 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 99.08 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 99.02 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 99.01 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.01 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 98.91 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 98.91 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.9 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 98.89 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 98.83 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 98.78 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 98.78 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 98.78 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 98.74 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 98.73 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 98.7 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 98.66 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 98.62 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 98.55 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 98.53 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 98.52 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 98.46 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 98.43 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 98.4 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 98.38 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 98.37 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 98.37 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.35 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.33 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 98.31 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 98.17 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 98.11 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 98.08 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 98.04 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 97.99 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 97.92 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 97.9 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 97.85 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 97.36 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 97.24 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 97.18 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 96.98 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 96.94 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 96.76 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 96.63 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 95.55 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 93.39 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 92.19 | |
| d2hqsa1 | 269 | TolB, C-terminal domain {Escherichia coli [TaxId: | 92.16 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 92.14 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 88.85 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 88.73 | |
| d2hqsa1 | 269 | TolB, C-terminal domain {Escherichia coli [TaxId: | 88.56 | |
| d1k32a2 | 281 | Tricorn protease N-terminal domain {Archaeon Therm | 87.23 | |
| d1c8ua2 | 171 | Thioesterase II (TesB) {Escherichia coli [TaxId: 5 | 83.88 |
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: beta1-subunit of the signal-transducing G protein heterotrimer species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.34 E-value=2e-12 Score=81.87 Aligned_cols=49 Identities=16% Similarity=0.224 Sum_probs=42.3
Q ss_pred eeeecCCCCCeEEEEEcCCCCEEEEEeCCCcEEEEECCCCCeEEEEEec
Q psy11104 7 KKIAIPNNTKVNCLAWHQNQGWIAVGGDDGLLKVLKLDTVSLTIMIILF 55 (70)
Q Consensus 7 ~~I~~~~~~~V~~va~spdg~~LasGg~Dg~IklWdi~~~~~~~~~~~~ 55 (70)
++.-.+|.+.|+||+|+|++++|||||.||+|+|||+.+++....+..+
T Consensus 48 ~~tL~GH~~~I~~l~~s~~~~~l~sgs~Dg~v~iWd~~~~~~~~~~~~~ 96 (340)
T d1tbga_ 48 RRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLR 96 (340)
T ss_dssp EEEECCCSSCEEEEEECTTSSEEEEEETTTEEEEEETTTTEEEEEEECS
T ss_pred eEEECCCCCCEEEEEECCCCCEEEEEECCCceeeeecccceeEEEEecc
Confidence 4445689999999999999999999999999999999998876665544
|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1c8ua2 d.38.1.3 (A:116-286) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|