Diaphorina citri psyllid: psy11137


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-
NTRLPSGAPSPSHQKRISRTPIIIIPAANTSLITMFVTTEAKRAAGSKRENEILIQRSKGDGTTVPYRVIDNPLKLARTDWDRVVAVFVMGPAWQFKGWPWDANPVEIFSKNLAVSRNFIQTTSCNQIIFGEFSWPKDVNTNYLHYQSSREGAVKKYYTLECLLFFLKNIGLNHTAYVRKAAASNIPVVPRPYRKDILAYLNGEVATSASIDKTAPLEIPTQVKRVGTEELETPAKKPRLEDSVHLQHVKQQLAARLDAPKEASVTLDNIKFGPGSLTEAMSVEKIAAIKAKRLAKKRTTIKRVATDTDGTDIGDKDAEKDNLKDMLAFDVDVTKNIISRERQWRTRTSIFHTSGKIFSKNIFAILQSIKAREEGRHRPAPPTPLVPSTPVNKSVPQPIVYNRYDQERFIKSREETEGFKIDTMGTYHGMTLKSVTEGNTPRKPALTPSTPAHQTPSATPNANAAASPAPYNINKKEIIERENQIIFGEFSWPKDVNTNYLHYQSSREGAVKKYYTLECLLFFLKNIGLNHTAYVRKAAASNIPVVPRPYRKDILAYLNGEVATSASIDKTAPLEIPTQVKRVGTEELETPAKKPRLEDSVHLQHVKQQLAARLDAPKEASVTLDNIKFGPGSLTEAMSVEKIAAIKAKRLAKKRTTIKRVATDTDGTDIGDKDAEKDNLKDMLAFDVDVTKNIISRERQWRTRTSIFHTSGKIFSKNIFAILQSIKAREEGRHRPAPPTPLVPSTPVNKSVPQPIVYNRYDQERFIKSREETEGFKIDTMGKGHMFVISTQSVSTEPQCPFRCICFRTTVRCMFQHLEYVPRVSNDTTIL
cccccccccccccccccccccEEEEcccccccHHHcccHHHHHccccccccEEEEEEEccccccccEEEEccccccccccccEEEEEEEEccccccccccccccHHHHHHHccccEEEEECcccccCEEEccccccccccccEEEEccccccccccEEHHHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccCEEcccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccEEECccccccccccccccccccccccccccccccccccccccccccEEEEccEEEEcccccccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHcHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHccccccccccEEccccccccEEEEECccccccccccccccccccHHHHccccccccccccccccc
*******************TPIIIIPAANTSLITMFVTTEA***********ILIQRSKGDGTTVPYRVIDNPLKLARTDWDRVVAVFVMGPAWQFKGWPWDANPVEIFSKNLAVSRNFIQTTSCNQIIFGEFSWPKDVNTNYLHYQSSREGAVKKYYTLECLLFFLKNIGLNHTAYVRKAAASNIPVVPRPYRKDILAYLNGEV******************************************************************F*******AMSVEKIAAIKAKRL****************************LKDMLAFDVDVTKNIISRERQWRTRTSIFHTSGKIFSKNIFAILQSI*****************************IVYNRYDQERFI*******GFKIDTMGTYHG*******************************************INKKEIIERENQIIFGEFSWPKDVNTNYLHYQSSREGAVKKYYTLECLLFFLKNIGLNHTAYVRKAAASNIPVVPRPYRKDILAYLNGEV*************************************************************LDN*K********AMSVEKIAAIKAKRL****************************LKDMLAFDVDVTKNIISRERQWRTRTSIFHTSGKIFSKNIFAILQSI*******************************YN*YDQERFIK****TEGFKIDTMGKGHMFVIST***STEPQCPFRCICFRTTVRCMFQHLEYVPRVS******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NTRLPSGAPSPSHQKRISRTPIIIIPAANTSLITMFVTTEAKRAAGSKRENEILIQRSKGDGTTVPYRVIDNPLKLARTDWDRVVAVFVMGPAWQFKGWPWDANPVEIFSKNLAVSRNFIQTTSCNQIIFGEFSWPKDVNTNYLHYQSSREGAVKKYYTLECLLFFLKNIGLNHTAYVRKAAASNIPVVPRPYRKDILAYLNGEVATSASIDKTAPLEIPTQVKRVGTEELETPAKKPRLEDSVHLQHVKQQLAARLDAPKEASVTLDNIKFGPGSLTEAMSVEKIAAIKAKRLAKKRTTIKRVATDTDGTDIGDKDAEKDNLKDMLAFDVDVTKNIISRERQWRTRTSIFHTSGKIFSKNIFAILQSIKAREEGRHRPAPPTPLVPSTPVNKSVPQPIVYNRYDQERFIKSREETEGFKIDTMGTYHGMTLKSVTEGNTPRKPALTPSTPAHQTPSATPNANAAASPAPYNINKKEIIERENQIIFGEFSWPKDVNTNYLHYQSSREGAVKKYYTLECLLFFLKNIGLNHTAYVRKAAASNIPVVPRPYRKDILAYLNGEVATSASIDKTAPLEIPTQVKRVGTEELETPAKKPRLEDSVHLQHVKQQLAARLDAPKEASVTLDNIKFGPGSLTEAMSVEKIAAIKAKRLAKKRTTIKRVATDTDGTDIGDKDAEKDNLKDMLAFDVDVTKNIISRERQWRTRTSIFHTSGKIFSKNIFAILQSIKAREEGRHRPAPPTPLVPSTPVNKSVPQPIVYNRYDQERFIKSREETEGFKIDTMGKGHMFVISTQSVSTEPQCPFRCICFRTTVRCMFQHLEYVPRVSNDTTIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Parafibromin Tumor suppressor probably involved in transcriptional and post-transcriptional control pathways. May be involved in cell cycle progression through the regulation of cyclin D1/PRAD1 expression. Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase II through interaction with POLR2A CTD non-phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms and is involved in transcriptional elongation, acting both indepentently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. PAF1C is required for transcription of Hox and Wnt target genes. PAF1C is involved in hematopoiesis and stimulates transcriptional activity of MLL1; it promotes leukemogenesis though association with MLL-rearranged oncoproteins, such as MLL-MLLT3/AF9 and MLL-MLLT1/ENL. PAF1C is involved in histone modifications such as ubiquitination of histone H2B and methylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits the RNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzyme UBE2A or UBE2B to chromatin which mediate monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2B ubiquitination is proposed to be coupled to transcription. PAF1C is involved in mRNA 3' end formation probably through association with cleavage and poly(A) factors. In case of infection by influenza A strain H3N2, PAF1C associates with viral NS1 protein, thereby regulating gene transcription. Connects PAF1C with the cleavage and polyadenylation specificity factor (CPSF) complex and the cleavage stimulation factor (CSTF) complex, and with Wnt signaling. Involved in polyadenylation of mRNA precursors.confidentQ6P1J9
Parafibromin Tumor suppressor probably involved in transcriptional and post-transcriptional control pathways. May be involved in cell cycle progression through the regulation of cyclin D1/PRAD1 expression. Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase II through interaction with POLR2A CTD non-phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms and is involved in transcriptional elongation, acting both indepentently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. PAF1C is required for transcription of Hox and Wnt target genes. PAF1C is involved in hematopoiesis and stimulates transcriptional activity of MLL1. PAF1C is involved in histone modifications such as ubiquitination of histone H2B and methylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits the RNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzyme UBE2A or UBE2B to chromatin which mediate monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2B ubiquitination is proposed to be coupled to transcription. PAF1C is involved in mRNA 3' end formation probably through association with cleavage and poly(A) factors. Connects PAF1C with the cleavage and polyadenylation specificity factor (CPSF) complex and the cleavage stimulation factor (CSTF) complex, and with Wnt signaling. Involved in polyadenylation of mRNA precursors.confidentQ8JZM7
Parafibromin Tumor suppressor probably involved in transcriptional and post-transcriptional control pathways. May be involved in cell cycle progression through the regulation of cyclin D1/PRAD1 expression. Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase II through interaction with POLR2A CTD non-phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms and is involved in transcriptional elongation, acting both indepentently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. PAF1C is required for transcription of Hox and Wnt target genes. PAF1C is involved in hematopoiesis and stimulates transcriptional activity of MLL1. PAF1C is involved in histone modifications such as ubiquitination of histone H2B and methylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits the RNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzyme UBE2A or UBE2B to chromatin which mediate monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2B ubiquitination is proposed to be coupled to transcription. PAF1C is involved in mRNA 3' end formation probably through association with cleavage and poly(A) factors. Connects PAF1C with the cleavage and polyadenylation specificity factor (CPSF) complex and the cleavage stimulation factor (CSTF) complex, and with Wnt signaling. Involved in polyadenylation of mRNA precursors.confidentQ4V8C8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016593 [CC]Cdc73/Paf1 complexprobableGO:0008023, GO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0033523 [BP]histone H2B ubiquitinationprobableGO:0044699, GO:0044267, GO:0044260, GO:0032446, GO:0006325, GO:0071840, GO:0070647, GO:0016043, GO:0071704, GO:0016570, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0016574, GO:0044237, GO:0043170, GO:0016567, GO:0008150, GO:0016568, GO:0016569
GO:0010390 [BP]histone monoubiquitinationprobableGO:0044699, GO:0044267, GO:0044260, GO:0032446, GO:0006325, GO:0071840, GO:0070647, GO:0016043, GO:0071704, GO:0016570, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006513, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0016574, GO:0044237, GO:0043170, GO:0016567, GO:0008150, GO:0016568, GO:0016569
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0000993 [MF]RNA polymerase II core bindingprobableGO:0019899, GO:0070063, GO:0043175, GO:0001098, GO:0001099, GO:0003674, GO:0005488, GO:0005515, GO:0032403
GO:2000134 [BP]negative regulation of G1/S transition of mitotic cell cycleprobableGO:0007346, GO:2000045, GO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:1901987, GO:0010948, GO:0065007, GO:1901991, GO:1901990, GO:0048519, GO:0048523, GO:0050789, GO:1901988
GO:0045638 [BP]negative regulation of myeloid cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0050789, GO:0045596, GO:0045595, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048519, GO:0002682, GO:0045637, GO:0048523
GO:0071222 [BP]cellular response to lipopolysaccharideprobableGO:0070887, GO:0032496, GO:0044699, GO:0051716, GO:0033993, GO:0009617, GO:0071310, GO:0071219, GO:0071216, GO:0009987, GO:0071396, GO:0008150, GO:0042221, GO:0051707, GO:0010033, GO:0051704, GO:1901700, GO:1901701, GO:0009607, GO:0050896, GO:0002237, GO:0044763
GO:0032968 [BP]positive regulation of transcription elongation from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0045935, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0034243, GO:0060255, GO:0032784, GO:0009889, GO:0032786, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0008285 [BP]negative regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0030177 [BP]positive regulation of Wnt receptor signaling pathwayprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0030111, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V46, chain A
Confidence level:very confident
Coverage over the Query: 17-123,135-171
View the alignment between query and template
View the model in PyMOL
Template: 2XOT, chain A
Confidence level:probable
Coverage over the Query: 792-831
View the alignment between query and template
View the model in PyMOL