Diaphorina citri psyllid: psy11140

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MSVGPKNIIYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIERLGSHNYLTDSEVGIRGKSEV
cccccCEEEEccccEEEEccccHHHHHHHHHHHHHcccccccccEEEEEEEEEEccccEEEEEEEEEEEcccccCEEEEEEEEECcccc
*SVGPKNIIYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIERLGSHNYLTDSEVGIRG****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVGPKNIIYNGGGYVKDLGSSESNMAQGLSQMIIHKWLDERTRVILIECSLYNPNINAIIAVSLMIERLGSHNYLTDSEVGIRGKSEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0031513 [CC]nonmotile primary ciliumprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0015077 [MF]monovalent inorganic cation transmembrane transporter activityprobableGO:0022891, GO:0022890, GO:0022892, GO:0005215, GO:0008324, GO:0015075, GO:0022857, GO:0003674
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005261 [MF]cation channel activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0005216, GO:0008324, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0022838
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0046873 [MF]metal ion transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0008324, GO:0015075, GO:0022857, GO:0003674
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0032501 [BP]multicellular organismal processprobableGO:0008150
GO:0034220 [BP]ion transmembrane transportprobableGO:0009987, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0044763, GO:0008150, GO:0051234, GO:0055085, GO:0044699
GO:0051726 [BP]regulation of cell cycleprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0065009 [BP]regulation of molecular functionprobableGO:0008150, GO:0065007
GO:0030001 [BP]metal ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted