Diaphorina citri psyllid: psy11143


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940
TDDRRSSTELVISGVQREHGGRYSCVAGNPAGVYRGDLHVTVNAPPIFIQRPVSTTYSTGSTSRITCLVEGHPLPQMTWFHDGNSLDSDDHVTYEHDGFVLVLNGVRESDAGVYNCVAQNSEGSAESVAMIRINGHRAPRLVVKPFDMRAPAGSSVEIPCKPDGEPLPRISWSKDEAEFVEDRNHKIHRTGSLRLYNIGPQDSGLYRCTASNLLGEDVAEGYLTVTGAPPIFIQRPVSTTYSTGSTSRITCLVEGHPLPQMTWFHDGNSLDSDDHVTYEHDGFVLVLNGVRESDAGVYNCVAQNSEGSAESVAMIRINGHRAPRLVVKPFDMRAPAGSSVEIPCKPDGEPLPRISWSKDEAEFVEDRNHKIHRTGSLRLYNIGPQDSGLYRCTASNLLGEDVAEGYLTVTGENSVEPAPHTSREPSASKPSVADDTIHMAVKLASREVDAAVNATINSLFGYHSNEQQDHGSLMKLLRFPDESARTVVRAADVYERTLSHIKKHIQAGVKMNLSEDLSLGKAFFSPWRLVDEGGVDPLLRGFITSPAKRKRPTENLNKELTDKLFTTFHAVSLDLAAMNIQRGRDHGIPEYNAWREYCGLPRANTFEDLAREITDRRVRDKLQRLYGHPGFSYHDVLSPRQIELIANLSGCMEHQRTANCSDLCFHTKYRTIDGTCNNLQHPMWGASLTGFRRLLKPIYENGFSTPVAPILSSPMAGNIDPFVGAILEDQVDGGRVGPTMRCLLIDQFKRIRDGNIDPFVGAILEDQVDGGRVGPTMRCLLIDQFKRIRDGNIDPFVGAILEDQVDGGRVGPTMRCLLIDQFKRIRDGDRFWYENPSTFKPAQLTQIKQASLARVICDSGDRLTEVRVCFSPRPTTSITPDPVITHMVMQWGQFLDHDLDHAIPATSLESWEGIDCKKSCAFSPPCFPMEVPHDDPGPTS
ccccccccEEEEccccccccCEEEEEEEcccCEEEEEEEEEEEccccCECcccCEEEEccccEEEEEEEEECcccEEEEEEccEEccccccEEEECcccEEEEccccccccEEEEEEEEEccccCEEEEEEEEEEcccccCECccccEEEcccccEEEEEEEccccccEEEEEEccEEccccccEEEECccEEEEccccccccEEEEEEEEEccCEEEEEEEEEECcccccccccccCEEEEcccEEEEEEEEEECcccEEEEEEccEEccccccEEEECcccEEEEccccccccCEEEEEEEEccccCEEEEEEEEEcccccCEECccccEEEcccccEEEEEEEECccccEEEEEEccEEccccccEEEECccEEEEccccccccCEEEEEEEEcccCEEEEEEEEEEccccccccccccccccccccccccccEEEEEEEEEEEccccccccccccccccccEEEccccEEEEEEEccccCEEEEEEEEccccEEEEEEEEEEcccEEEcccccccccCECccEEEEccccccccEEEEEccccccccccccccccccccEEEEcccHHHHHHcccccccccccccccccccEEccccccccccccHHHHHHHHHHHHHccccccccCECccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccEEEEEEEccccccccccEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccEEECccccccccccEEEEHHHHHHcccccccCEEECccccccHHHHHHHHHHcEEEEEEcccccCEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*****SSTELVISGVQREHGGRYSCVAGNPAGVYRGDLHVTVNAPPIFIQRPVSTTYSTGSTSRITCLVEGHPLPQMTWFHDGNSLDSDDHVTYEHDGFVLVLNGVRESDAGVYNCVAQNSEGSAESVAMIRINGHRAPRLVVKPFDMRAPAGSSVEIPCKPDGEPLPRISWSKDEAEFVEDRNHKIHRTGSLRLYNIGPQDSGLYRCTASNLLGEDVAEGYLTVTGAPPIFIQRPVSTTYSTGSTSRITCLVEGHPLPQMTWFHDGNSLDSDDHVTYEHDGFVLVLNGVRESDAGVYNCVAQNSEGSAESVAMIRINGHRAPRLVVKPFDMRAPAGSSVEIPCKPDGEPLPRISWSKDEAEFVEDRNHKIHRTGSLRLYNIGPQDSGLYRCTASNLLGEDVAEGYLTVTGENSVEPAPHT*R*****KPSVADDTIHMAVKLASREVDAAVNATINSLFGYHS*******SLMKLLRFPDESARTVVRAADVYERTLSHIKKHIQAGVKMNLSEDLSLGKAFFSPWRLVDEGGVDPLLRGFITSPAKR*********ELTDKLFTTFHAVSLDLAAMNIQRGRDHGIPEYNAWREYCGLPRANTFEDLAREITDRRVRDKLQRLYGHPGFSYHDVLSPRQIELIANLSGCMEHQRTANCSDLCFHTKYRTIDGTCNNLQHPMWGASLTGFRRLLKPIYENGFSTPVAPILSSPMAGNIDPFVGAILEDQVDGGRVGPTMRCLLIDQFKRIRDGNIDPFVGAILEDQVDGGRVGPTMRCLLIDQFKRIRDGNIDPFVGAILEDQVDGGRVGPTMRCLLIDQFKRIRDGDRFWYENPSTFKPAQLTQIKQASLARVICDSGDRLTEVRVCFSPRPTTSITPDPVITHMVMQWGQFLDHDLDHAIPATSLESWEGIDCKKSCAFSPPCFPMEV**D******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TDDRRSSTELVISGVQREHGGRYSCVAGNPAGVYRGDLHVTVNAPPIFIQRPVSTTYSTGSTSRITCLVEGHPLPQMTWFHDGNSLDSDDHVTYEHDGFVLVLNGVRESDAGVYNCVAQNSEGSAESVAMIRINGHRAPRLVVKPFDMRAPAGSSVEIPCKPDGEPLPRISWSKDEAEFVEDRNHKIHRTGSLRLYNIGPQDSGLYRCTASNLLGEDVAEGYLTVTGAPPIFIQRPVSTTYSTGSTSRITCLVEGHPLPQMTWFHDGNSLDSDDHVTYEHDGFVLVLNGVRESDAGVYNCVAQNSEGSAESVAMIRINGHRAPRLVVKPFDMRAPAGSSVEIPCKPDGEPLPRISWSKDEAEFVEDRNHKIHRTGSLRLYNIGPQDSGLYRCTASNLLGEDVAEGYLTVTGENSVEPAPHTSREPSASKPSVADDTIHMAVKLASREVDAAVNATINSLFGYHSNEQQDHGSLMKLLRFPDESARTVVRAADVYERTLSHIKKHIQAGVKMNLSEDLSLGKAFFSPWRLVDEGGVDPLLRGFITSPAKRKRPTENLNKELTDKLFTTFHAVSLDLAAMNIQRGRDHGIPEYNAWREYCGLPRANTFEDLAREITDRRVRDKLQRLYGHPGFSYHDVLSPRQIELIANLSGCMEHQRTANCSDLCFHTKYRTIDGTCNNLQHPMWGASLTGFRRLLKPIYENGFSTPVAPILSSPMAGNIDPFVGAILEDQVDGGRVGPTMRCLLIDQFKRIRDGNIDPFVGAILEDQVDGGRVGPTMRCLLIDQFKRIRDGNIDPFVGAILEDQVDGGRVGPTMRCLLIDQFKRIRDGDRFWYENPSTFKPAQLTQIKQASLARVICDSGDRLTEVRVCFSPRPTTSITPDPVITHMVMQWGQFLDHDLDHAIPATSLESWEGIDCKKSCAFSPPCFPMEVPHDDPGPTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V2A, chain R
Confidence level:very confident
Coverage over the Query: 6-47
View the alignment between query and template
View the model in PyMOL
Template: 3V2A, chain R
Confidence level:very confident
Coverage over the Query: 7-140
View the alignment between query and template
View the model in PyMOL
Template: 3Q9K, chain A
Confidence level:very confident
Coverage over the Query: 484-630,718,793-867,880-913
View the alignment between query and template
View the model in PyMOL
Template: 3Q9K, chain A
Confidence level:very confident
Coverage over the Query: 646-718,795-810,848-854,873-937
View the alignment between query and template
View the model in PyMOL
Template: 1CXP, chain C
Confidence level:probable
Coverage over the Query: 519-630
View the alignment between query and template
View the model in PyMOL