Diaphorina citri psyllid: psy11150


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYLPPRFMSVSQAAQQLVEITKTKPGLSTADLAVGIARVGSETQHIVATSLSDMTETNMGKPLHSLIISDESKIKDLLEKEKLIDEELAHLEQAVEIRDVVMSKLHEYNDIKDATQIVIGTLANLQQVTVRKLHEDFGLDKPSY
ccccccEEEEEccccccccccHHHHHHHHHHccccEEEEEEcccccccHHHHHcccccccccccccHHHHHHHHHHHHHcccccccccEEEEEEccccccccccccccccccccccccccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccc
LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLT***RQYLPPRFMSVSQAAQQLVEITKTKPGLSTADLAVGIARVGSETQHIVATSLSDMT*******LHSLIISDESKIKDLLEKEKLIDEELAHLEQAVEIRDVVMSKLHEYNDIKDATQIVIGTLANLQQVTVRKLHEDFGLD****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYLPPRFMSVSQAAQQLVEITKTKPGLSTADLAVGIARVGSETQHIVATSLSDMTETNMGKPLHSLIISDESKxxxxxxxxxxxxxxxxxxxxxVEIRDVVMSKLHEYNDIKDATQIVIGTLANLQQVTVRKLHEDFGLDKPSY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Diphthine synthase S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis.confidentQ9CWQ0
Diphthine synthase S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis.confidentQ4HZI0
Diphthine synthase S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis.confidentQ5E982

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I4T, chain A
Confidence level:very confident
Coverage over the Query: 1-46,60-133
View the alignment between query and template
View the model in PyMOL
Template: 3VIQ, chain B
Confidence level:confident
Coverage over the Query: 147-200
View the alignment between query and template
View the model in PyMOL