Psyllid ID: psy11150

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYLPPRFMSVSQAAQQLVEITKTKPGLSTADLAVGIARVGSETQHIVATSLSDMTETNMGKPLHSLIISDESKIKDLLEKEKLIDEELAHLEQAVEIRDVVMSKLHEYNDIKDATQIVIGTLANLQQVTVRKLHEDFGLDKPSY
ccccccEEEEEccccccccccHHHHHHHHHHccccEEEEEEcccccccHHHHHHccccccccccccHHHHHHHHHHHHHcccccccccEEEEEEccccccccccccccccccccccccccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccc
cccccEEEEEEccccccccccHHHHHHHHHHccccEEEEEEEEEccccHHHHHccccEccccccccHHHHHHHHHHHHHHccccccccEEEEEEEEcccccEEEEccHHHHHHccccccccEEEEEcccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccc
lynfgetvsipfwteswkpdsfydKIVENKSRGLHTLCLLDiqvkeptlesltkktrqylpprfmsVSQAAQQLVEItktkpglstaDLAVGIARVGSETQHIVATSLsdmtetnmgkplhsliisDESKIKDLLEKEKLIDEELAHLEQAVEIRDVVMSKLheyndikdATQIVIGTLANLQQVTVRKLHedfgldkpsy
lynfgetvsipfwteswkpdsfYDKIVENKSRGLHTLCLLDiqvkeptlesltKKTRQYLPPRFMSVSQAAQQLVEItktkpglstADLAVGIARVGSETQHIVATslsdmtetnmGKPLHSLIISDESKIKDLLEKEKLIDEELAHLEQAVEIRDVVMSKLHEYNDIKDATQIVIGTLANLQQVTVRKLhedfgldkpsy
LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYLPPRFMSVSQAAQQLVEITKTKPGLSTADLAVGIARVGSETQHIVATSLSDMTETNMGKPLHSLIISDESkikdllekeklideelAHLEQAVEIRDVVMSKLHEYNDIKDATQIVIGTLANLQQVTVRKLHEDFGLDKPSY
***FGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLT***RQYLPPRFMSV**AAQQLVEITKTKPGLSTADLAVGIARVGSETQHIVATS************LHSLIISDESKIKDLLEKEKLIDEELAHLEQAVEIRDVVMSKLHEYNDIKDATQIVIGTLANLQQVTVRKLHED********
LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLES**********PRFMSVSQAAQQLVEITKTKPGLSTADLAVGIARVGSETQHIVATSLSDMT***********IISDESKIKDLLEKEKLIDEELAHLEQAVEIRDVVMSKLHEYNDIKDATQIVIGTLANLQQVTVRKLHEDFGLD****
LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYLPPRFMSVSQAAQQLVEITKTKPGLSTADLAVGIARVGSETQHIVATSLSDMTETNMGKPLHSLIISDESKIKDLLEKEKLIDEELAHLEQAVEIRDVVMSKLHEYNDIKDATQIVIGTLANLQQVTVRKLHEDFGLDKPSY
LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYLPPRFMSVSQAAQQLVEITKTKPGLSTADLAVGIARVGSETQHIVATSLSDMTETNMGKPLHSLIISDESKIKDLLEKEKLIDEELAHLEQAVEIRDVVMSKLHEYNDIKDATQIVIGTLANLQQVTVRKLH**FGLDK***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYLPPRFMSVSQAAQQLVEITKTKPGLSTADLAVGIARVGSETQHIVATSLSDMTETNMGKPLHSLIISDESKxxxxxxxxxxxxxxxxxxxxxVEIRDVVMSKLHEYNDIKDATQIVIGTLANLQQVTVRKLHEDFGLDKPSY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query201 2.2.26 [Sep-21-2011]
Q5E982285 Diphthine synthase OS=Bos yes N/A 0.641 0.452 0.540 8e-39
Q9H2P9285 Diphthine synthase OS=Hom yes N/A 0.641 0.452 0.533 2e-38
Q9CWQ0281 Diphthine synthase OS=Mus yes N/A 0.626 0.448 0.530 3e-38
O81769277 Probable diphthine syntha yes N/A 0.636 0.462 0.548 1e-35
Q5BFG0285 Diphthine synthase OS=Eme no N/A 0.621 0.438 0.527 1e-33
Q6FXK9298 Diphthine synthase OS=Can yes N/A 0.621 0.419 0.511 2e-32
Q6C1E0300 Diphthine synthase OS=Yar yes N/A 0.621 0.416 0.519 3e-32
Q4HZI0287 Diphthine synthase OS=Gib yes N/A 0.621 0.435 0.511 6e-32
Q6MY91285 Diphthine synthase OS=Neo yes N/A 0.621 0.438 0.503 1e-31
Q7S949287 Diphthine synthase OS=Neu N/A N/A 0.621 0.435 0.488 2e-30
>sp|Q5E982|DPH5_BOVIN Diphthine synthase OS=Bos taurus GN=DPH5 PE=2 SV=1 Back     alignment and function desciption
 Score =  159 bits (403), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 100/135 (74%), Gaps = 6/135 (4%)

Query: 1   LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYL 60
           LY FGETVSI FWT++W+P+SF+DK+ +N+  G+HTLCLLDI+VKE +LE+L K  + Y 
Sbjct: 124 LYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYE 183

Query: 61  PPRFMSVSQAAQQLVEITKTK------PGLSTADLAVGIARVGSETQHIVATSLSDMTET 114
           PPR+MSV+QAAQQL+EI + +      P ++   L VG+ARVG+E Q I A +L  M+  
Sbjct: 184 PPRYMSVNQAAQQLLEIVQNQRIRGEEPAVTEETLCVGLARVGAEDQKIAAGTLQQMSTV 243

Query: 115 NMGKPLHSLIISDES 129
           ++G PLHSLII+  S
Sbjct: 244 DLGGPLHSLIITGGS 258
S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis.
Bos taurus (taxid: 9913)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 9EC: 8
>sp|Q9H2P9|DPH5_HUMAN Diphthine synthase OS=Homo sapiens GN=DPH5 PE=1 SV=2 Back     alignment and function description
>sp|Q9CWQ0|DPH5_MOUSE Diphthine synthase OS=Mus musculus GN=Dph5 PE=2 SV=2 Back     alignment and function description
>sp|O81769|DPH5_ARATH Probable diphthine synthase OS=Arabidopsis thaliana GN=At4g31790 PE=2 SV=1 Back     alignment and function description
>sp|Q5BFG0|DPH5_EMENI Diphthine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph5 PE=3 SV=2 Back     alignment and function description
>sp|Q6FXK9|DPH5_CANGA Diphthine synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DPH5 PE=3 SV=1 Back     alignment and function description
>sp|Q6C1E0|DPH5_YARLI Diphthine synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH5 PE=3 SV=1 Back     alignment and function description
>sp|Q4HZI0|DPH5_GIBZE Diphthine synthase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH5 PE=3 SV=1 Back     alignment and function description
>sp|Q6MY91|DPH5_ASPFU Diphthine synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph5 PE=3 SV=1 Back     alignment and function description
>sp|Q7S949|DPH5_NEUCR Diphthine synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-5 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
158292140286 AGAP004412-PA [Anopheles gambiae str. PE 0.631 0.444 0.617 7e-43
332018283285 Diphthine synthase [Acromyrmex echinatio 0.636 0.449 0.585 3e-41
307189822283 Diphthine synthase [Camponotus floridanu 0.636 0.452 0.592 4e-41
189237643273 PREDICTED: similar to Diphthamide methyl 0.626 0.461 0.603 7e-41
307204878281 Diphthine synthase [Harpegnathos saltato 0.621 0.444 0.572 3e-40
156551147283 PREDICTED: diphthine synthase [Nasonia v 0.641 0.455 0.602 3e-40
170045280301 diphthine synthase [Culex quinquefasciat 0.621 0.415 0.613 3e-40
195390628281 GJ24174 [Drosophila virilis] gi|19415205 0.621 0.444 0.603 5e-40
357608299269 hypothetical protein KGM_17421 [Danaus p 0.621 0.464 0.627 7e-40
195444582281 GK11785 [Drosophila willistoni] gi|19416 0.621 0.444 0.595 2e-39
>gi|158292140|ref|XP_313697.4| AGAP004412-PA [Anopheles gambiae str. PEST] gi|157017293|gb|EAA09127.4| AGAP004412-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 87/141 (61%), Positives = 103/141 (73%), Gaps = 14/141 (9%)

Query: 1   LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYL 60
           LY+FGETVSIP+W +SWKPDSFYDKIV N   GLHTLCLLDI+VKEPTLESL KK R+Y+
Sbjct: 124 LYHFGETVSIPYWDDSWKPDSFYDKIVANLKHGLHTLCLLDIKVKEPTLESLMKKKREYM 183

Query: 61  PPRFMSVSQAAQQLVEITKTKP--------------GLSTADLAVGIARVGSETQHIVAT 106
           PPRFMSVS+AA QL++I   K               GLS   L VG+ARVG +TQ I+A 
Sbjct: 184 PPRFMSVSEAADQLLQIVAKKSDAEAGVQPDQQNEHGLSENTLIVGLARVGHDTQQILAC 243

Query: 107 SLSDMTETNMGKPLHSLIISD 127
           SLS+M   ++G PLHSLII +
Sbjct: 244 SLSEMRNVDLGPPLHSLIIPN 264

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332018283|gb|EGI58888.1| Diphthine synthase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307189822|gb|EFN74094.1| Diphthine synthase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|189237643|ref|XP_966949.2| PREDICTED: similar to Diphthamide methyltransferase CG31289-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307204878|gb|EFN83433.1| Diphthine synthase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|156551147|ref|XP_001604120.1| PREDICTED: diphthine synthase [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|170045280|ref|XP_001850243.1| diphthine synthase [Culex quinquefasciatus] gi|167868230|gb|EDS31613.1| diphthine synthase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195390628|ref|XP_002053970.1| GJ24174 [Drosophila virilis] gi|194152056|gb|EDW67490.1| GJ24174 [Drosophila virilis] Back     alignment and taxonomy information
>gi|357608299|gb|EHJ65922.1| hypothetical protein KGM_17421 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195444582|ref|XP_002069933.1| GK11785 [Drosophila willistoni] gi|194166018|gb|EDW80919.1| GK11785 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
FB|FBgn0024558281 Dph5 "Diphthamide methyltransf 0.621 0.444 0.580 9.2e-36
UNIPROTKB|Q5E982285 DPH5 "Diphthine synthase" [Bos 0.641 0.452 0.540 1.3e-34
UNIPROTKB|E2RQL8280 DPH5 "Uncharacterized protein" 0.641 0.460 0.511 2.2e-34
UNIPROTKB|Q9H2P9285 DPH5 "Diphthine synthase" [Hom 0.641 0.452 0.533 2.8e-34
MGI|MGI:1916990281 Dph5 "DPH5 homolog (S. cerevis 0.626 0.448 0.530 2.8e-34
UNIPROTKB|F1S569285 DPH5 "Uncharacterized protein" 0.641 0.452 0.540 3.6e-34
RGD|1307867281 Dph5 "DPH5 homolog (S. cerevis 0.626 0.448 0.530 4.6e-34
ZFIN|ZDB-GENE-041114-85288 dph5 "DPH5 homolog (S. cerevis 0.626 0.437 0.537 8.5e-33
TAIR|locus:2124859277 AT4G31790 [Arabidopsis thalian 0.636 0.462 0.556 1.4e-32
UNIPROTKB|F1P418286 DPH5 "Uncharacterized protein" 0.626 0.440 0.5 9.8e-32
FB|FBgn0024558 Dph5 "Diphthamide methyltransferase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 386 (140.9 bits), Expect = 9.2e-36, P = 9.2e-36
 Identities = 76/131 (58%), Positives = 97/131 (74%)

Query:     1 LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYL 60
             LY FGETVSIP+W E+WKPDSFYDKI  N+   +HTLCLLDI+VKEPT ESL +K ++Y+
Sbjct:   124 LYKFGETVSIPYWDETWKPDSFYDKIKLNRLHNMHTLCLLDIKVKEPTPESLMRKRKEYM 183

Query:    61 PPRFMSVSQAAQQLVEITKTKPGL--STA----DLAVGIARVGSETQHIVATSLSDMTET 114
             PPRFM+V++AA QL+ I + K  L  +T      L VG+ARVG E+Q I   +L +M  T
Sbjct:   184 PPRFMTVAEAAHQLLSIVEKKDSLEKNTVLNEQSLCVGLARVGQESQQIAVGTLLEMRST 243

Query:   115 NMGKPLHSLII 125
             ++G PLHSLII
Sbjct:   244 DLGGPLHSLII 254
GO:0004164 "diphthine synthase activity" evidence=ISS
GO:0017183 "peptidyl-diphthamide biosynthetic process from peptidyl-histidine" evidence=ISS
UNIPROTKB|Q5E982 DPH5 "Diphthine synthase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQL8 DPH5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2P9 DPH5 "Diphthine synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1916990 Dph5 "DPH5 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1S569 DPH5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1307867 Dph5 "DPH5 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041114-85 dph5 "DPH5 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2124859 AT4G31790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1P418 DPH5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9CWQ0DPH5_MOUSE2, ., 1, ., 1, ., 9, 80.53030.62680.4483yesN/A
Q6C1E0DPH5_YARLI2, ., 1, ., 1, ., 9, 80.51960.62180.4166yesN/A
Q6MY91DPH5_ASPFU2, ., 1, ., 1, ., 9, 80.50390.62180.4385yesN/A
Q6FXK9DPH5_CANGA2, ., 1, ., 1, ., 9, 80.51180.62180.4194yesN/A
Q5E982DPH5_BOVIN2, ., 1, ., 1, ., 9, 80.54070.64170.4526yesN/A
O81769DPH5_ARATH2, ., 1, ., 1, ., 9, 80.54880.63680.4620yesN/A
Q9H2P9DPH5_HUMAN2, ., 1, ., 1, ., 9, 80.53330.64170.4526yesN/A
Q4HZI0DPH5_GIBZE2, ., 1, ., 1, ., 9, 80.51160.62180.4355yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
PTZ00175270 PTZ00175, PTZ00175, diphthine synthase; Provisiona 4e-59
cd11647241 cd11647, Diphthine_synthase, Diphthine synthase, a 2e-51
COG1798260 COG1798, DPH5, Diphthamide biosynthesis methyltran 1e-34
TIGR00522257 TIGR00522, dph5, diphthine synthase 1e-31
PRK04160258 PRK04160, PRK04160, diphthine synthase; Provisiona 2e-29
pfam0706181 pfam07061, Swi5, Swi5 4e-11
>gnl|CDD|185500 PTZ00175, PTZ00175, diphthine synthase; Provisional Back     alignment and domain information 
 Score =  185 bits (473), Expect = 4e-59
 Identities = 73/127 (57%), Positives = 98/127 (77%), Gaps = 2/127 (1%)

Query: 1   LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYL 60
           LY FGETVSIPF+TE+WKPDSFYDKI  N+  GLHTLCLLDI+VKE ++E+L K  + Y 
Sbjct: 126 LYRFGETVSIPFFTETWKPDSFYDKIKANRDNGLHTLCLLDIKVKERSVENLMKGRKIYE 185

Query: 61  PPRFMSVSQAAQQLVEITKTKPGLSTAD--LAVGIARVGSETQHIVATSLSDMTETNMGK 118
           PPR+M+++QA +QL+E+ + K G   A+  L VG+ARVGS+ Q IV+ +L D+ + + G 
Sbjct: 186 PPRYMTINQAIEQLLEVEEKKGGGVIAEDTLVVGVARVGSDDQQIVSGTLEDLLDVDFGP 245

Query: 119 PLHSLII 125
           PLHSL+I
Sbjct: 246 PLHSLVI 252

Length = 270
>gnl|CDD|212506 cd11647, Diphthine_synthase, Diphthine synthase, also known as DPH5 Back     alignment and domain information
>gnl|CDD|224711 COG1798, DPH5, Diphthamide biosynthesis methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233007 TIGR00522, dph5, diphthine synthase Back     alignment and domain information
>gnl|CDD|235231 PRK04160, PRK04160, diphthine synthase; Provisional Back     alignment and domain information
>gnl|CDD|219282 pfam07061, Swi5, Swi5 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 201
KOG3123|consensus272 100.0
PTZ00175270 diphthine synthase; Provisional 100.0
COG1798260 DPH5 Diphthamide biosynthesis methyltransferase [T 100.0
TIGR00522257 dph5 diphthine synthase. This protein participates 99.94
PF0706183 Swi5: Swi5; InterPro: IPR010760 This entry represe 99.9
PRK04160258 diphthine synthase; Provisional 99.75
TIGR01469236 cobA_cysG_Cterm uroporphyrin-III C-methyltransfera 98.47
PRK06136249 uroporphyrin-III C-methyltransferase; Reviewed 98.14
PRK05991250 precorrin-3B C17-methyltransferase; Provisional 97.97
PRK10637457 cysG siroheme synthase; Provisional 97.78
TIGR01465229 cobM_cbiF precorrin-4 C11-methyltransferase. This 97.43
PF00590210 TP_methylase: Tetrapyrrole (Corrin/Porphyrin) Meth 97.37
PRK05787210 cobalt-precorrin-6Y C(5)-methyltransferase; Valida 97.3
PLN02625263 uroporphyrin-III C-methyltransferase 97.02
TIGR01466239 cobJ_cbiH precorrin-3B C17-methyltransferase. This 96.75
COG2875254 CobM Precorrin-4 methylase [Coenzyme metabolism] 95.65
PRK15478241 cbiH cobalt-precorrin-3B C(17)-methyltransferase; 95.44
PRK05765246 precorrin-3B C17-methyltransferase; Provisional 94.42
PRK07168 474 bifunctional uroporphyrinogen-III methyltransferas 93.5
PRK15473257 cbiF cobalt-precorrin-4 C(11)-methyltransferase; P 93.36
TIGR02467204 CbiE precorrin-6y C5,15-methyltransferase (decarbo 93.14
COG2241210 CobL Precorrin-6B methylase 1 [Coenzyme metabolism 92.08
COG0007244 CysG Uroporphyrinogen-III methylase [Coenzyme meta 87.13
PRK14994287 SAM-dependent 16S ribosomal RNA C1402 ribose 2'-O- 86.69
PRK05576229 cobalt-precorrin-2 C(20)-methyltransferase; Valida 80.33
>KOG3123|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.9e-62  Score=418.92  Aligned_cols=134  Identities=55%  Similarity=0.972  Sum_probs=131.4

Q ss_pred             CCcCCceeEeeccCCCcccCchHHHHHHHhhCCCeeeEeeecccCCcchhHhhhccccCCCCCCCCHHHHHHHHHHHhhc
Q psy11150          1 LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYLPPRFMSVSQAAQQLVEITKT   80 (201)
Q Consensus         1 ~YrFG~tvSIpf~~~~~~P~S~yd~I~~N~~~gLHTL~LLDIk~~e~~~e~~~~g~~~y~p~r~Mt~~eA~~~Lle~e~~   80 (201)
                      +|+||+|||||||+++|+|+||||+|++|+++|||||||||||+||||+|||+||||+||||||||+++|++||||++++
T Consensus       125 lY~fGetVSiv~ftd~wrP~SfydkI~~Nr~~glHTLcLLDIkvkEqs~enl~rgrkiyeppRymsvn~a~~QlLei~e~  204 (272)
T KOG3123|consen  125 LYNFGETVSIVFFTDNWRPESFYDKIKENRQLGLHTLCLLDIKVKEQSVENLARGRKIYEPPRYMSVNEAAEQLLEIEEK  204 (272)
T ss_pred             eeccCcEEEEEEEccCcCchhHHHHHHHhhhcCceeEEEEEEeeccHHHHHHhccccccCCchhhhHHHHHHHHHHHHHh
Confidence            69999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             C--CCCCCCceEEEEeecCCCCceEEeecccchhcCCCCCCCeEEEEecCCChhHH
Q psy11150         81 K--PGLSTADLAVGIARVGSETQHIVATSLSDMTETNMGKPLHSLIISDESKIKDL  134 (201)
Q Consensus        81 ~--~~~~~dt~~v~~aR~G~~dq~I~~g~l~el~~~dfG~PlHslIIpg~lH~qeL  134 (201)
                      +  .++++||+|||+||+||+||+|++||+++|++.|||+|||||||||++|+-|+
T Consensus       205 ~~~~~~~edT~~v~~~R~Gs~~q~i~~gt~~~l~~~d~G~PLHslii~ge~h~lE~  260 (272)
T KOG3123|consen  205 RGEPAYTEDTLCVAVARVGSDDQKIVAGTIKDLAEVDFGEPLHSLIIPGETHPLEL  260 (272)
T ss_pred             hCCCCcCCCceEEEEEecCCCcceeeheeHHhHhhcccCCCceeEEeecCcChHHH
Confidence            8  58999999999999999999999999999999999999999999999998765

>PTZ00175 diphthine synthase; Provisional Back     alignment and domain information
>COG1798 DPH5 Diphthamide biosynthesis methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00522 dph5 diphthine synthase Back     alignment and domain information
>PF07061 Swi5: Swi5; InterPro: IPR010760 This entry represents Swi5 and is involved in meiotic DNA repair synthesis and meiotic joint molecule formation [] Back     alignment and domain information
>PRK04160 diphthine synthase; Provisional Back     alignment and domain information
>TIGR01469 cobA_cysG_Cterm uroporphyrin-III C-methyltransferase Back     alignment and domain information
>PRK06136 uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>PRK05991 precorrin-3B C17-methyltransferase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>TIGR01465 cobM_cbiF precorrin-4 C11-methyltransferase Back     alignment and domain information
>PF00590 TP_methylase: Tetrapyrrole (Corrin/Porphyrin) Methylases Note this Prosite entry does not include all members of this family Back     alignment and domain information
>PRK05787 cobalt-precorrin-6Y C(5)-methyltransferase; Validated Back     alignment and domain information
>PLN02625 uroporphyrin-III C-methyltransferase Back     alignment and domain information
>TIGR01466 cobJ_cbiH precorrin-3B C17-methyltransferase Back     alignment and domain information
>COG2875 CobM Precorrin-4 methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK15478 cbiH cobalt-precorrin-3B C(17)-methyltransferase; Provisional Back     alignment and domain information
>PRK05765 precorrin-3B C17-methyltransferase; Provisional Back     alignment and domain information
>PRK07168 bifunctional uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>PRK15473 cbiF cobalt-precorrin-4 C(11)-methyltransferase; Provisional Back     alignment and domain information
>TIGR02467 CbiE precorrin-6y C5,15-methyltransferase (decarboxylating), CbiE subunit Back     alignment and domain information
>COG2241 CobL Precorrin-6B methylase 1 [Coenzyme metabolism] Back     alignment and domain information
>COG0007 CysG Uroporphyrinogen-III methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK14994 SAM-dependent 16S ribosomal RNA C1402 ribose 2'-O-methyltransferase; Provisional Back     alignment and domain information
>PRK05576 cobalt-precorrin-2 C(20)-methyltransferase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
3i4t_A292 Crystal Structure Of Putative Diphthine Synthase Fr 4e-27
2egl_A265 Crystal Structure Of Glu171 To Lys Mutant Of Diphth 2e-13
2dsi_A265 Crystal Structure Of Glu171 To Arg Mutant Of Diphth 3e-13
2eh5_A265 Mutant L184m Structure Of Ph0725 From Pyrococcus Ho 4e-13
2egb_A265 Crystal Structure Of Glu140 To Asn Mutant Of Diphth 4e-13
2pb6_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 4e-13
2p5f_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 5e-13
2eni_A265 Mutant F197m Structure Of Ph0725 From Pyrococcus Ho 5e-13
2pcg_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 5e-13
2ek2_A265 Structural Study Of Project Id Ph0725 From Pyrococc 5e-13
2ed3_A265 Mutant I127m Structure Of Ph0725 From Pyrococcus Ho 5e-13
2e16_A265 Crystal Structure Of Glu140 To Arg Mutant Of Diphth 5e-13
2e08_A265 Crystal Structure Of Glu140 To Lys Mutant Of Diphth 5e-13
2e7r_A265 Crystal Structure Of Glu54 To Arg Mutant Of Diphthi 6e-13
2owu_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2e8r_A265 Structural Study Of Project Id Ph0725 From Pyrococc 6e-13
2e8q_A265 Structural Study Of Project Id Ph0725 From Pyrococc 6e-13
2hux_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2ehl_A265 Crystal Structure Of Thr146 To Arg Mutant Of Diphth 6e-13
2huv_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2owg_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2e4r_A265 Mutant I253m Structure Of Ph0725 From Pyrococcus Ho 6e-13
2dv3_A265 Crystal Structure Of Leu65 To Arg Mutant Of Diphthi 6e-13
2pck_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2dxw_A265 Crystal Structure Of Glu54 To Lys Mutant Of Diphthi 6e-13
2dv4_A265 Crystal Structure Of Leu65 To Gln Mutant Of Diphthi 6e-13
2dsh_A265 Crystal Structure Of Lys26 To Tyr Mutant Of Diphthi 6e-13
2z6r_A265 Crystal Structure Of Lys49 To Arg Mutant Of Diphthi 6e-13
2dsg_A265 Crystal Structure Of Lys26 To Arg Mutant Of Diphthi 6e-13
2p6i_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2p6d_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2dv5_A265 Crystal Structure Of Leu65 To Ala Mutant Of Diphthi 6e-13
1wng_A265 Structural Study Of Project Id Ph0725 From Pyrococc 6e-13
2emu_A265 Mutant L21h Structure Of Ph0725 From Pyrococcus Hor 6e-13
2ehc_A265 Crystal Structure Of Asn69 To Lys Mutant Of Diphthi 6e-13
2dxv_A265 Crystal Structure Of Glu54 To His Mutant Of Diphthi 6e-13
2pcm_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2pca_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2pb5_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2p9d_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2p5c_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2en5_A265 Mutant R262h Structure Of Ph0725 From Pyrococcus Ho 6e-13
2emr_A265 Mutant L65m Structure Of Ph0725 From Pyrococcus Hor 6e-13
2el3_A265 Structural Study Of Project Id Ph0725 From Pyrococc 6e-13
2el1_A265 Structural Study Of Project Id Ph0725 From Pyrococc 6e-13
2el0_A265 Structural Study Of Project Id Ph0725 From Pyrococc 6e-13
2ek4_A265 Structural Study Of Project Id Ph0725 From Pyrococc 6e-13
2ek3_A265 Structural Study Of Project Id Ph0725 From Pyrococc 6e-13
2ejk_A265 Mutant L38m Structure Of Ph0725 From Pyrococcus Hor 6e-13
2eh2_A265 Mutant V18m Structure Of Ph0725 From Pyrococcus Hor 6e-13
2egs_A265 Crystal Structure Of Leu261 To Met Mutant Of Diphth 6e-13
2e4n_A265 Mutant V251m Structure Of Ph0725 From Pyrococcus Ho 6e-13
2hut_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2huq_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2eeq_A265 Mutant Y29m Structure Of Ph0725 From Pyrococcus Hor 6e-13
2ejz_A265 Structural Study Of Project Id Ph0725 From Pyrococc 6e-13
2e07_A265 Crystal Structure Of Asp79 To Glu Mutant Of Diphthi 6e-13
2hr8_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-13
2e8h_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 7e-13
2pch_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 7e-13
2ele_A265 Mutant V18c Structure Of Ph0725 From Pyrococcus Hor 7e-13
2e17_A265 Crystal Structure Of Arg173 To Ala Mutant Of Diphth 7e-13
2dv7_A265 Crystal Structure Of Lys187 To Arg Mutant Of Diphth 7e-13
2dxx_A265 Crystal Structure Of Asn142 To Glu Mutant Of Diphth 9e-13
2eh4_A265 Mutant T146m Structure Of Ph0725 From Pyrococcus Ho 9e-13
2ejj_A265 Mutant K129m Structure Of Ph0725 From Pyrococcus Ho 9e-13
2p6k_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 1e-12
2e15_A265 Crystal Structure Of Arg173 To Asn Mutant Of Diphth 1e-12
2eld_A265 Mutant L160m Structure Of Ph0725 From Pyrococcus Ho 1e-12
2el2_A265 Structural Study Of Project Id Ph0725 From Pyrococc 1e-12
2eka_A265 Structural Study Of Project Id Ph0725 From Pyrococc 1e-12
2ek7_A265 Structural Study Of Project Id Ph0725 From Pyrococc 1e-12
2pb4_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 1e-12
2e8s_A265 Structural Study Of Project Id Ph0725 From Pyrococc 1e-12
2owv_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 2e-12
2ed5_A265 Mutant S147m Structure Of Ph0725 From Pyrococcus Ho 2e-12
1vce_A265 Crystal Structure Of Project Id Ph0725 From Pyrococ 3e-12
2p2x_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 6e-12
2owf_A265 Crystal Structure Of Ph0725 From Pyrococcus Horikos 1e-11
1vhv_A268 Crystal Structure Of Diphthine Synthase Length = 26 3e-04
>pdb|3I4T|A Chain A, Crystal Structure Of Putative Diphthine Synthase From Entamoeba Histolytica Length = 292 Back     alignment and structure 
Iteration: 1

 Score =  117 bits (293), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 82/127 (64%), Gaps = 2/127 (1%)
Query: 1   LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYL 60
           LY FG+TVS+ FW+E W+P S+Y KI  N+   +HTL LLDI+VKE + ES+ K    + 
Sbjct: 145 LYRFGQTVSVCFWSEHWRPSSYYPKIKINRDNNMHTLVLLDIKVKERSEESIIKGRDIFE 204
Query: 61  PPRFMSVSQAAQQLVEITKTKP-GLSTAD-LAVGIARVGSETQHIVATSLSDMTETNMGK 118
           PPR+M+++Q  +QL+E+ K +  G+   D + VG+ARV    Q IV   + D+   + G 
Sbjct: 205 PPRYMTINQCIEQLLEVEKEQHLGVYDEDTMVVGMARVACADQKIVYGKMKDLLHYDFGA 264
Query: 119 PLHSLII 125
           P+H L+I
Sbjct: 265 PMHCLLI 271
>pdb|2EGL|A Chain A, Crystal Structure Of Glu171 To Lys Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2DSI|A Chain A, Crystal Structure Of Glu171 To Arg Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2EH5|A Chain A, Mutant L184m Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2EGB|A Chain A, Crystal Structure Of Glu140 To Asn Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2PB6|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2P5F|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2ENI|A Chain A, Mutant F197m Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2PCG|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2EK2|A Chain A, Structural Study Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 (E140m) Length = 265 Back     alignment and structure
>pdb|2ED3|A Chain A, Mutant I127m Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2E16|A Chain A, Crystal Structure Of Glu140 To Arg Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2E08|A Chain A, Crystal Structure Of Glu140 To Lys Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2E7R|A Chain A, Crystal Structure Of Glu54 To Arg Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2OWU|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2E8R|A Chain A, Structural Study Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2E8Q|A Chain A, Structural Study Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 (K19m) Length = 265 Back     alignment and structure
>pdb|2HUX|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2EHL|A Chain A, Crystal Structure Of Thr146 To Arg Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2HUV|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2OWG|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2E4R|A Chain A, Mutant I253m Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2DV3|A Chain A, Crystal Structure Of Leu65 To Arg Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2PCK|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2DXW|A Chain A, Crystal Structure Of Glu54 To Lys Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2DV4|A Chain A, Crystal Structure Of Leu65 To Gln Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2DSH|A Chain A, Crystal Structure Of Lys26 To Tyr Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2Z6R|A Chain A, Crystal Structure Of Lys49 To Arg Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2DSG|A Chain A, Crystal Structure Of Lys26 To Arg Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2P6I|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2P6D|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2DV5|A Chain A, Crystal Structure Of Leu65 To Ala Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|1WNG|A Chain A, Structural Study Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2EMU|A Chain A, Mutant L21h Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2EHC|A Chain A, Crystal Structure Of Asn69 To Lys Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2DXV|A Chain A, Crystal Structure Of Glu54 To His Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2PCM|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2PCA|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2PB5|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2P9D|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2P5C|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2EN5|A Chain A, Mutant R262h Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2EMR|A Chain A, Mutant L65m Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2EL3|A Chain A, Structural Study Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 (L242m) Length = 265 Back     alignment and structure
>pdb|2EL1|A Chain A, Structural Study Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 (L44m) Length = 265 Back     alignment and structure
>pdb|2EL0|A Chain A, Structural Study Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 (L21m) Length = 265 Back     alignment and structure
>pdb|2EK4|A Chain A, Structural Study Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 (L8m) Length = 265 Back     alignment and structure
>pdb|2EK3|A Chain A, Structural Study Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 (L3m) Length = 265 Back     alignment and structure
>pdb|2EJK|A Chain A, Mutant L38m Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2EH2|A Chain A, Mutant V18m Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2EGS|A Chain A, Crystal Structure Of Leu261 To Met Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2E4N|A Chain A, Mutant V251m Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2HUT|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2HUQ|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2EEQ|A Chain A, Mutant Y29m Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2EJZ|A Chain A, Structural Study Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 (y11m) Length = 265 Back     alignment and structure
>pdb|2E07|A Chain A, Crystal Structure Of Asp79 To Glu Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2HR8|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2E8H|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2PCH|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2ELE|A Chain A, Mutant V18c Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2E17|A Chain A, Crystal Structure Of Arg173 To Ala Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2DV7|A Chain A, Crystal Structure Of Lys187 To Arg Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2DXX|A Chain A, Crystal Structure Of Asn142 To Glu Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2EH4|A Chain A, Mutant T146m Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2EJJ|A Chain A, Mutant K129m Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2P6K|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2E15|A Chain A, Crystal Structure Of Arg173 To Asn Mutant Of Diphthine Synthase Length = 265 Back     alignment and structure
>pdb|2ELD|A Chain A, Mutant L160m Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2EL2|A Chain A, Structural Study Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 (l185m) Length = 265 Back     alignment and structure
>pdb|2EKA|A Chain A, Structural Study Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 (L202m) Length = 265 Back     alignment and structure
>pdb|2EK7|A Chain A, Structural Study Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 (L163m) Length = 265 Back     alignment and structure
>pdb|2PB4|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2E8S|A Chain A, Structural Study Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2OWV|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2ED5|A Chain A, Mutant S147m Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|1VCE|A Chain A, Crystal Structure Of Project Id Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2P2X|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|2OWF|A Chain A, Crystal Structure Of Ph0725 From Pyrococcus Horikoshii Ot3 Length = 265 Back     alignment and structure
>pdb|1VHV|A Chain A, Crystal Structure Of Diphthine Synthase Length = 268 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
3i4t_A292 Diphthine synthase; niaid, ssgcid, infectious dise 1e-34
2z6r_A265 Diphthine synthase; methyltransferase, S-adenosyl- 2e-29
1wde_A294 Probable diphthine synthase; structural genomics, 8e-27
1vhv_A268 Diphthine synthase; structural genomics, transfera 8e-25
>3i4t_A Diphthine synthase; niaid, ssgcid, infectious disease, anaerobic parasitic protozoan, structural genomics, decode, UW, SBRI; 2.49A {Entamoeba histolytica} Length = 292 Back     alignment and structure
 Score =  122 bits (308), Expect = 1e-34
 Identities = 56/142 (39%), Positives = 84/142 (59%), Gaps = 4/142 (2%)

Query: 1   LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYL 60
           LY FG+TVS+ FW+E W+P S+Y KI  N+   +HTL LLDI+VKE + ES+ K    + 
Sbjct: 145 LYRFGQTVSVCFWSEHWRPSSYYPKIKINRDNNMHTLVLLDIKVKERSEESIIKGRDIFE 204

Query: 61  PPRFMSVSQAAQQLVEITK--TKPGLSTADLAVGIARVGSETQHIVATSLSDMTETNMGK 118
           PPR+M+++Q  +QL+E+ K           + VG+ARV    Q IV   + D+   + G 
Sbjct: 205 PPRYMTINQCIEQLLEVEKEQHLGVYDEDTMVVGMARVACADQKIVYGKMKDLLHYDFGA 264

Query: 119 PLHSLIISDESKIKDLLEKEKL 140
           P+H L+I   +   D  E ++L
Sbjct: 265 PMHCLLIP--APQVDDPELDQL 284
>2z6r_A Diphthine synthase; methyltransferase, S-adenosyl-L-methionine, transferase; HET: SAH MES; 1.50A {Pyrococcus horikoshii} PDB: 2dek_A* 1wng_A* 1vce_A* 2ed3_A* 2e4r_A* 2owg_A* 2ek3_A* 2pcm_A* 2p5c_A* 2hut_A* 2emr_A* 2el3_A* 2el0_A* 2ejk_A* 2eld_A* 2el2_A* 2eka_A* 2eh5_A* 2pcg_A* 2el1_A* ... Length = 265 Back     alignment and structure
>1wde_A Probable diphthine synthase; structural genomics, conserved hypothetical protein, riken S genomics/proteomics initiative, RSGI, transferase; 2.00A {Aeropyrum pernix} SCOP: c.90.1.1 Length = 294 Back     alignment and structure
>1vhv_A Diphthine synthase; structural genomics, transferase; HET: MSE; 1.75A {Archaeoglobus fulgidus} SCOP: c.90.1.1 Length = 268 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
3i4t_A292 Diphthine synthase; niaid, ssgcid, infectious dise 99.96
3viq_B85 Mating-type switching protein SWI5; recombination 99.9
2z6r_A265 Diphthine synthase; methyltransferase, S-adenosyl- 99.73
1wde_A294 Probable diphthine synthase; structural genomics, 99.7
1vhv_A268 Diphthine synthase; structural genomics, transfera 99.47
1va0_A239 Uroporphyrin-III C-methyltransferase; structural g 97.96
2ybo_A294 Methyltransferase; SUMT, NIRE, heme D1 biosynthesi 97.9
1ve2_A235 Uroporphyrin-III C-methyltransferase; heme, biosyn 97.76
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 97.72
1s4d_A280 Uroporphyrin-III C-methyltransferase; tetrapyrrole 97.7
2zvb_A295 Precorrin-3 C17-methyltransferase; plasmid, struct 97.59
1cbf_A285 Cobalt-precorrin-4 transmethylase; precorrin-4 met 97.58
1wyz_A242 Putative S-adenosylmethionine-dependent methyltra; 97.2
2e0n_A259 Precorrin-2 C20-methyltransferase; cobalt-factor I 96.95
2qbu_A232 Precorrin-2 methyltransferase; HET: SAH; 2.10A {Me 95.92
3kwp_A296 Predicted methyltransferase; putative methyltransf 95.74
3nut_A251 Precorrin-3 methylase; vitamin B12 pathway, cobala 95.4
2bb3_A221 Cobalamin biosynthesis precorrin-6Y methylase (CB; 95.15
3ndc_A264 Precorrin-4 C(11)-methyltransferase; SAH; HET: SAH 94.48
4e16_A253 Precorrin-4 C(11)-methyltransferase; structural ge 94.15
3ffy_A115 Putative tetrapyrrole (corrin/porphyrin) methylas; 86.04
>3i4t_A Diphthine synthase; niaid, ssgcid, infectious disease, anaerobic parasitic protozoan, structural genomics, decode, UW, SBRI; 2.49A {Entamoeba histolytica} Back     alignment and structure
Probab=99.96  E-value=4e-29  Score=220.25  Aligned_cols=133  Identities=40%  Similarity=0.735  Sum_probs=113.6

Q ss_pred             CCcCCceeEeeccCCCcccCchHHHHHHHhhCCCeeeEeeecccCCcchhHhhhccccCCCCCCCCHHHHHHHHHHHhhc
Q psy11150          1 LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYLPPRFMSVSQAAQQLVEITKT   80 (201)
Q Consensus         1 ~YrFG~tvSIpf~~~~~~P~S~yd~I~~N~~~gLHTL~LLDIk~~e~~~e~~~~g~~~y~p~r~Mt~~eA~~~Lle~e~~   80 (201)
                      +++||.++|++|++.+|+|.++++.+..|+.++.|||||+|++++|+|++||+||+++|+|||||+++.++++|+++++.
T Consensus       145 l~~~~~~~sv~~~t~~~~p~~~~~~~~~~l~~~~~Tlvl~d~~~~e~~~~~~~~~~~~y~p~r~m~~~~~~~~L~~~~~~  224 (292)
T 3i4t_A          145 LYRFGQTVSVCFWSEHWRPSSYYPKIKINRDNNMHTLVLLDIKVKERSEESIIKGRDIFEPPRYMTINQCIEQLLEVEKE  224 (292)
T ss_dssp             GGGBCCCEEECCCBTTBCCCTHHHHHHHHHHTTCBEEEEECEECCC-------------CCCEECCHHHHHHHHHHHHHH
T ss_pred             cccCCceeEEEEEeCCCCCCccHHHHHHHhhcCCCeEEEEeccccccchhhccccccccCCccccCHHHHHHHHHHHHHH
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999998765


Q ss_pred             C--CCCCCCceEEEEeecCCCCceEEeecccchhcCCCCCCCeEEEEecC-CChhH
Q psy11150         81 K--PGLSTADLAVGIARVGSETQHIVATSLSDMTETNMGKPLHSLIISDE-SKIKD  133 (201)
Q Consensus        81 ~--~~~~~dt~~v~~aR~G~~dq~I~~g~l~el~~~dfG~PlHslIIpg~-lH~qe  133 (201)
                      .  +.+++++.+++++|+|+++|+|..+|+++|.+.+||.|+|++||+|+ ||+.|
T Consensus       225 l~~~g~~~dtpv~vv~~~t~~~E~i~~~tL~~l~~~~~~~~~~~liivG~~l~~~e  280 (292)
T 3i4t_A          225 QHLGVYDEDTMVVGMARVACADQKIVYGKMKDLLHYDFGAPMHCLLIPAPQVDDPE  280 (292)
T ss_dssp             HCCCSCCTTCEEEEEESTTSTTCEEEEEEHHHHTTCCCCSSCEEEEECCSSCCHHH
T ss_pred             HHhcCCCCCCEEEEEeecCCCceEEEEEEHHHHHhhhcCCCCCEEEEECCcCCHHH
Confidence            2  57888999999999999999999999999999999999999999996 99874
>3viq_B Mating-type switching protein SWI5; recombination activator; 2.20A {Schizosaccharomyces pombe} PDB: 3vir_A* Back     alignment and structure
>2z6r_A Diphthine synthase; methyltransferase, S-adenosyl-L-methionine, transferase; HET: SAH MES; 1.50A {Pyrococcus horikoshii} PDB: 2dek_A* 1wng_A* 1vce_A* 2ed3_A* 2e4r_A* 2owg_A* 2ek3_A* 2pcm_A* 2p5c_A* 2hut_A* 2emr_A* 2el3_A* 2el0_A* 2ejk_A* 2eld_A* 2el2_A* 2eka_A* 2eh5_A* 2pcg_A* 2el1_A* ... Back     alignment and structure
>1wde_A Probable diphthine synthase; structural genomics, conserved hypothetical protein, riken S genomics/proteomics initiative, RSGI, transferase; 2.00A {Aeropyrum pernix} SCOP: c.90.1.1 Back     alignment and structure
>1vhv_A Diphthine synthase; structural genomics, transferase; HET: MSE; 1.75A {Archaeoglobus fulgidus} SCOP: c.90.1.1 Back     alignment and structure
>1va0_A Uroporphyrin-III C-methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.97A {Thermus thermophilus} SCOP: c.90.1.1 PDB: 1v9a_A Back     alignment and structure
>2ybo_A Methyltransferase; SUMT, NIRE, heme D1 biosynthesis; HET: SAH; 2.00A {Pseudomonas aeruginosa} PDB: 2ybq_A* Back     alignment and structure
>1ve2_A Uroporphyrin-III C-methyltransferase; heme, biosynthesis, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: c.90.1.1 Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1s4d_A Uroporphyrin-III C-methyltransferase; tetrapyrrole biosynthesis, cobalamin, SAM, SAH, uroporphyrin methyltransferase; HET: SAH; 2.70A {Pseudomonas denitrificans} SCOP: c.90.1.1 Back     alignment and structure
>2zvb_A Precorrin-3 C17-methyltransferase; plasmid, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SAH; 2.00A {Thermus thermophilus} PDB: 2zvc_A* Back     alignment and structure
>1cbf_A Cobalt-precorrin-4 transmethylase; precorrin-4 methyltransferase, cobalamin biosynth methyltransferase; HET: SAH; 2.40A {Bacillus megaterium} SCOP: c.90.1.1 PDB: 2cbf_A* Back     alignment and structure
>1wyz_A Putative S-adenosylmethionine-dependent methyltra; northeast structural genomics consortium, BTR28, methyltrans PSI; 2.50A {Bacteroides thetaiotaomicron} SCOP: c.90.1.1 Back     alignment and structure
>2e0n_A Precorrin-2 C20-methyltransferase; cobalt-factor II, tetrapyrrole, S-adenosylmethi transferase; HET: SAH; 2.00A {Chlorobaculum tepidum} PDB: 2e0k_A* Back     alignment and structure
>2qbu_A Precorrin-2 methyltransferase; HET: SAH; 2.10A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3kwp_A Predicted methyltransferase; putative methyltransferase, MCSG, STRU genomics, PSI-2, protein structure initiative; 2.29A {Lactobacillus brevis atcc 367} Back     alignment and structure
>3nut_A Precorrin-3 methylase; vitamin B12 pathway, cobalamin, methyltransferase, transfera; HET: SAH; 2.22A {Rhodobacter capsulatus} Back     alignment and structure
>2bb3_A Cobalamin biosynthesis precorrin-6Y methylase (CB; beta, alpha-beta-alpha sandwich, structural genomics, PSI, P structure initiative; HET: SAH; 2.27A {Archaeoglobus fulgidus} SCOP: c.90.1.1 Back     alignment and structure
>3ndc_A Precorrin-4 C(11)-methyltransferase; SAH; HET: SAH; 2.00A {Rhodobacter capsulatus} PDB: 3nei_A Back     alignment and structure
>4e16_A Precorrin-4 C(11)-methyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.49A {Clostridium difficile} Back     alignment and structure
>3ffy_A Putative tetrapyrrole (corrin/porphyrin) methylas; structural genomics, APC62130.1, methyltransferase, PSI-2, P structure initiative; 2.00A {Bacteroides fragilis} PDB: 3fq6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 201
d2deka1265 c.90.1.1 (A:1-265) Diphthine synthase, DphB {Pyroc 6e-21
d1wdea_289 c.90.1.1 (A:) Diphthine synthase, DphB {Aeropyrum 5e-17
d1vhva_251 c.90.1.1 (A:) Diphthine synthase, DphB {Archaeon A 2e-15
>d2deka1 c.90.1.1 (A:1-265) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]} Length = 265 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Tetrapyrrole methylase
superfamily: Tetrapyrrole methylase
family: Tetrapyrrole methylase
domain: Diphthine synthase, DphB
species: Pyrococcus horikoshii [TaxId: 53953]

 Score = 85.2 bits (210), Expect = 6e-21
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 17/127 (13%)

Query: 1   LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYL 60
           +Y FG++ ++ +   +W P S+YD I EN  RGLHTL  LDI+ ++              
Sbjct: 127 IYKFGKSATVAYPEGNWFPTSYYDVIKENAERGLHTLLFLDIKAEKR------------- 173

Query: 61  PPRFMSVSQAAQQLVEITKT--KPGLSTADLAVGIARVGSETQHIVATSLSDMTETNMGK 118
              +M+ ++A + L+++         +   L V +AR GS    I A  + D+   + G 
Sbjct: 174 --MYMTANEAMELLLKVEDMKKGGVFTDDTLVVVLARAGSLNPTIRAGYVKDLIREDFGD 231

Query: 119 PLHSLII 125
           P H LI+
Sbjct: 232 PPHILIV 238
>d1wdea_ c.90.1.1 (A:) Diphthine synthase, DphB {Aeropyrum pernix [TaxId: 56636]} Length = 289 Back     information, alignment and structure
>d1vhva_ c.90.1.1 (A:) Diphthine synthase, DphB {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 251 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
d1wdea_289 Diphthine synthase, DphB {Aeropyrum pernix [TaxId: 99.93
d2deka1265 Diphthine synthase, DphB {Pyrococcus horikoshii [T 99.85
d1vhva_251 Diphthine synthase, DphB {Archaeon Archaeoglobus f 99.82
d1va0a1225 Hypothetical protein TTHA0667 {Thermus thermophilu 97.99
d1s4da_265 Uroporphyrin-III C-methyltransferase (SUMT, UROM, 97.98
d1ve2a1235 Uroporphyrin-III C-methyltransferase (SUMT, UROM, 97.91
d1cbfa_239 Cobalt precorrin-4 methyltransferase CbiF {Bacillu 97.85
d1pjqa2242 Siroheme synthase CysG, domains 4 and 5 {Salmonell 97.57
d2bb3a1195 Precorrin-6y methylase CbiE {Archaeoglobus fulgidu 91.8
d1wyza1233 Putative methytransferase BT4190 {Bacteroides thet 87.65
>d1wdea_ c.90.1.1 (A:) Diphthine synthase, DphB {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Tetrapyrrole methylase
superfamily: Tetrapyrrole methylase
family: Tetrapyrrole methylase
domain: Diphthine synthase, DphB
species: Aeropyrum pernix [TaxId: 56636]

Probab=99.93  E-value=1e-26  Score=199.77  Aligned_cols=117  Identities=24%  Similarity=0.270  Sum_probs=108.6

Q ss_pred             CCcCCceeEeeccCCCcccCchHHHHHHHhhCCCeeeEeeecccCCcchhHhhhccccCCCCCCCCHHHHHHHHHHHhhc
Q psy11150          1 LYNFGETVSIPFWTESWKPDSFYDKIVENKSRGLHTLCLLDIQVKEPTLESLTKKTRQYLPPRFMSVSQAAQQLVEITKT   80 (201)
Q Consensus         1 ~YrFG~tvSIpf~~~~~~P~S~yd~I~~N~~~gLHTL~LLDIk~~e~~~e~~~~g~~~y~p~r~Mt~~eA~~~Lle~e~~   80 (201)
                      +|+||.++|+||++.+|+|.|++++|..|+.+|+|||||+|++..                .+||.+.+|+.+|+++.++
T Consensus       129 ~~~f~~~~sl~~~~~~~~p~s~~~~i~~~~~~~l~tlvl~~~~~~----------------~~~m~~~~~~~~l~e~~~~  192 (289)
T d1wdea_         129 FYRFGGTVTLPGPWRGVTPISVARRIYLNLCAGLHTTALLDVDER----------------GVQLSPGQGVSLLLEADRE  192 (289)
T ss_dssp             GGGEEEEEEECCGGGCCCCHHHHHHHHHHHHHTCEEEEEECBCTT----------------SCBCCHHHHHHHHHHHHHH
T ss_pred             cccccEEEEeeeecCCcCCCchHHHHHHHHHcCCchhhhhhcccc----------------CceeeHHHHHHHHHHHHHH
Confidence            489999999999999999999999999999999999999999854                4899999999999998765


Q ss_pred             C-------CCCCCCceEEEEeecCCCCceEEeecccchhcCCCCCCCeEEEEecCCChhH
Q psy11150         81 K-------PGLSTADLAVGIARVGSETQHIVATSLSDMTETNMGKPLHSLIISDESKIKD  133 (201)
Q Consensus        81 ~-------~~~~~dt~~v~~aR~G~~dq~I~~g~l~el~~~dfG~PlHslIIpg~lH~qe  133 (201)
                      .       ..+.+++.|++++|+|+++|+|..||++||.+.|||+|+|||||||++|+-|
T Consensus       193 ~~~~~~~~~~~~~~~~v~v~~~lg~~~E~i~~gtl~el~~~~~~~p~~~liipg~~~~~E  252 (289)
T d1wdea_         193 YAREAGAPALLARLPSVLVEAGAGGGHRVLYWSSLERLSTADVEGGVYSIVIPARLSGVE  252 (289)
T ss_dssp             HHHHHTSCCCGGGSCEEEEECCGGGCCEEEEESCHHHHHTCCCCCCCCEEEECSSCCHHH
T ss_pred             HHHhccchhhhCCCCeEEEEEeCCCCCcEEEeeeHHHHHhhhcCCCCEEEEEECCCChHH
Confidence            3       3567899999999999999999999999999999999999999999999853
>d2deka1 c.90.1.1 (A:1-265) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vhva_ c.90.1.1 (A:) Diphthine synthase, DphB {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1va0a1 c.90.1.1 (A:2-226) Hypothetical protein TTHA0667 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s4da_ c.90.1.1 (A:) Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) {Pseudomonas denitrificans [TaxId: 43306]} Back     information, alignment and structure
>d1ve2a1 c.90.1.1 (A:1-235) Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cbfa_ c.90.1.1 (A:) Cobalt precorrin-4 methyltransferase CbiF {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1pjqa2 c.90.1.1 (A:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bb3a1 c.90.1.1 (A:1-195) Precorrin-6y methylase CbiE {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wyza1 c.90.1.1 (A:2-234) Putative methytransferase BT4190 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure