Diaphorina citri psyllid: psy11152


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
METLNLLATSLQSNYDMVHFGHANNLRQAKELGNYLVVGVHTDEEISKHKGPPVFTQQERYKMVRGIKWVDEVVEGAPYVTTLETLDAYDCDFCVHGALEVLVSLESSVSAL
ccccccEEEEEccccccccHHHHHHHHHHHHcccEEEEEEcccHHHHHccccccccHHHHHHHHHccccccEECccccccccHHHHHHccccEEEEccccccccccccEEcc
****NLLATSLQSNYDMVHFGHANNLRQAKELGNYLVVGVHTDEEISKHKGPPVFTQQERYKMVRGIKWVDEVVEGAPYVTTLETLDAYDCDFCVHGALEVLVSLESSVSAL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METLNLLATSLQSNYDMVHFGHANNLRQAKELGNYLVVGVHTDEEISKHKGPPVFTQQERYKMVRGIKWVDEVVEGAPYVTTLETLDAYDCDFCVHGALEVLVSLESSVSAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ethanolamine-phosphate cytidylyltransferase Plays an important role in the biosynthesis of the phospholipid phosphatidylethanolamine. Catalyzes the formation of CDP-ethanolamine.confidentQ5EA75
Ethanolamine-phosphate cytidylyltransferase Plays an important role in the biosynthesis of the phospholipid phosphatidylethanolamine. Catalyzes the formation of CDP-ethanolamine.confidentQ922E4
Ethanolamine-phosphate cytidylyltransferase Plays an important role in the biosynthesis of the phospholipid phosphatidylethanolamine. Catalyzes the formation of CDP-ethanolamine.confidentQ55BZ4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004306 [MF]ethanolamine-phosphate cytidylyltransferase activityprobableGO:0016779, GO:0003824, GO:0016772, GO:0070567, GO:0016740, GO:0003674
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006657 [BP]CDP-choline pathwayprobableGO:0006656, GO:0006650, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0044283, GO:0044255, GO:1901576, GO:0044710, GO:0044711, GO:0008150, GO:0071704, GO:0006644, GO:0006629, GO:0009308, GO:0045017, GO:0046165, GO:0009987, GO:0044106, GO:0009058, GO:0042439, GO:0008152, GO:0046486, GO:0090407, GO:0008610, GO:0044238, GO:1901564, GO:0006576, GO:1901566, GO:0008654, GO:0044237, GO:0046470, GO:0006066, GO:0006796, GO:0006793, GO:0019637, GO:0046474, GO:1901617, GO:1901615
GO:0031307 [CC]integral to mitochondrial outer membraneprobableGO:0031975, GO:0043229, GO:0031306, GO:0031301, GO:0031300, GO:0032592, GO:0043227, GO:0043226, GO:0031224, GO:0005737, GO:0005575, GO:0031090, GO:0016021, GO:0016020, GO:0044444, GO:0005739, GO:0044455, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0005740, GO:0005741, GO:0044429, GO:0044424, GO:0044425, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ELB, chain A
Confidence level:very confident
Coverage over the Query: 3-104
View the alignment between query and template
View the model in PyMOL