Diaphorina citri psyllid: psy11170


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MFVTKIPSRYPLLTLMSNMGYDDKRQAIQFSAEVLNRCYIQYSNIAARTLRRALKTEFRADAEKREESFIRITPWKDGKPIRHYSEPLHYVTPILLQDDLDIFSISTPLLH
ccccccccccccHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHccccCEEEECcccccccccccccHHHHHHHHHcccccEEEccccccc
*******SRYPLLTLMSNMGYDDKRQAIQFSAEVLNRCYIQYSNIAARTLRRALKTEFRADAE*REESFIRITPWKDGKPIRHYSEPLHYVTPILLQDDLDIFSISTPLL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVTKIPSRYPLLTLMSNMGYDDKRQAIQFSAEVLNRCYIQYSNIAARTLRRALKTEFRADAEKREESFIRITPWKDGKPIRHYSEPLHYVTPILLQDDLDIFSISTPLLH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045261 [CC]proton-transporting ATP synthase complex, catalytic core F(1)probableGO:0043234, GO:0005575, GO:0032991, GO:0016020, GO:0044464, GO:0045259, GO:0005623, GO:0005622, GO:0033178, GO:0044424, GO:0044425, GO:0016469
GO:0006172 [BP]ADP biosynthetic processprobableGO:0009185, GO:0009180, GO:0044237, GO:0009188, GO:0044249, GO:0034641, GO:0009165, GO:0009163, GO:0072521, GO:0072522, GO:0009133, GO:0009259, GO:1901360, GO:1901362, GO:0006139, GO:0044710, GO:0009132, GO:0090407, GO:0009179, GO:0042278, GO:0008150, GO:0071704, GO:0055086, GO:0046483, GO:0044281, GO:0018130, GO:0009987, GO:1901576, GO:0006725, GO:0006793, GO:0046031, GO:0009152, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0009116, GO:0008152, GO:0034654, GO:1901564, GO:0009119, GO:0046128, GO:0009135, GO:0042455, GO:0009136, GO:0046129, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:0006807, GO:0042451, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0006753, GO:1901659
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005753 [CC]mitochondrial proton-transporting ATP synthase complexprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0044444, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0045259, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0005740, GO:0044429, GO:0044424, GO:0044425, GO:0016469, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OEE, chain I
Confidence level:very confident
Coverage over the Query: 37-86
View the alignment between query and template
View the model in PyMOL