Diaphorina citri psyllid: psy11186


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
IPPAVSNAGVKVIPENAKIDSDNEQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLLAARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIPQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHPTLAEEFTRVTITKRSGEDPTPQSCCS
cccccccccEEEcccccEEcccccccccccEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccEEccccccccccccHHHHHHHHccccEEEEEcccccccccccccccccEEEEEEEEcccccEEEEEEEEccccHHHHHHHHHHHHccccHHHHcccccccccccEEEEEEEEccccccccccccccc
IPPAVSNAGVKVIPENAKIDSDNEQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLLAARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIPQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHPTLAEEFTRVTIT**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IPPAVSNAGVKVIPENAKIDSDNEQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLLAARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIPQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHPTLAEEFTRVTITKRSGEDPTPQSCCS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin reductase 2, mitochondrial Maintains mitochondrial thioredoxin in a reduced state. Implicated in the defenses against oxidative stress. May play a role in redox-regulated cell signaling.confidentQ9Z0J5
Thioredoxin reductase 2, mitochondrial Maintains thioredoxin in a reduced state. Implicated in the defenses against oxidative stress. May play a role in redox-regulated cell signaling.confidentQ9N2I8
Thioredoxin reductase 2, mitochondrial Maintains thioredoxin in a reduced state. Implicated in the defenses against oxidative stress. May play a role in redox-regulated cell signaling.confidentQ9JLT4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004791 [MF]thioredoxin-disulfide reductase activityprobableGO:0016209, GO:0003824, GO:0003674, GO:0016651, GO:0016667, GO:0016668, GO:0016491
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0000305 [BP]response to oxygen radicalprobableGO:1901700, GO:0050896, GO:0000302, GO:0006950, GO:0008150, GO:0042221, GO:0010035, GO:0006979
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007369 [BP]gastrulationprobableGO:0048598, GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0070995 [BP]NADPH oxidationprobableGO:0006739, GO:0006732, GO:0006733, GO:0034641, GO:0006807, GO:0046496, GO:0072524, GO:1901360, GO:0006139, GO:0044710, GO:0051186, GO:0071704, GO:0055086, GO:0044281, GO:0009987, GO:0006725, GO:0009117, GO:0008152, GO:0055114, GO:0046483, GO:0044238, GO:1901564, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0019362
GO:0042542 [BP]response to hydrogen peroxideprobableGO:1901700, GO:0050896, GO:0000302, GO:0006950, GO:0008150, GO:0042221, GO:0010035, GO:0006979
GO:0006749 [BP]glutathione metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006575, GO:0043603, GO:0006082, GO:0006520, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0006790, GO:0019752, GO:0008152, GO:0043436, GO:0008150, GO:0006518, GO:0044281
GO:0070482 [BP]response to oxygen levelsprobableGO:0009628, GO:0050896, GO:0008150
GO:0042537 [BP]benzene-containing compound metabolic processprobableGO:0009987, GO:0006725, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:1901360
GO:0033797 [MF]selenate reductase activityprobableGO:0003824, GO:0003674, GO:0016491
GO:0033554 [BP]cellular response to stressprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0016174 [MF]NAD(P)H oxidase activityprobableGO:0003824, GO:0016491, GO:0003674, GO:0016651, GO:0050664
GO:0045340 [MF]mercury ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0050661 [MF]NADP bindingprobableGO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0050660 [MF]flavin adenine dinucleotide bindingprobableGO:0043168, GO:0050662, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0045454 [BP]cell redox homeostasisprobableGO:0019725, GO:0009987, GO:0050794, GO:0042592, GO:0044763, GO:0008150, GO:0065007, GO:0065008, GO:0050789, GO:0044699
GO:0051262 [BP]protein tetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DGH, chain A
Confidence level:very confident
Coverage over the Query: 4-39,51-203
View the alignment between query and template
View the model in PyMOL