Psyllid ID: psy11186

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
IPPAVSNAGVKVIPENAKIDSDNEQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLLAARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIPQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHPTLAEEFTRVTITKRSGEDPTPQSCCS
cccccccccEEEcccccEEcccccccccccEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccEEccccccccccccHHHHHHHHccccEEEEEcccccccccccccccccEEEEEEEEcccccEEEEEEEEccccHHHHHHHHHHHHccccHHHHcccccccccccEEEEEEEEccccccccccccccc
ccccHHHccEEEcccccEEEccccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccEEEEcccccccccccHHHHHHHHccccEEEEEEEccccEEEEcccccccEEEEEEEEcccccEEEEEEEEcccHHHHHHHHHHHHHHccEHHHHHcccccccccHHHHEEEEEEcccccccccccccc
ippavsnagvkvipenakidsdneqtnipnvfavgdvlhfspfpvlplfqekpeltpVAVQAGKLLAARLygngttqmdyqnvattvftpleygcvglseekaeelygadnleiyhayykpteffipqrnpqrcylkvvceraapqkvlgmhfigpnaGEVIQGYAAAVKCGLTFetlestvgihptlaeefTRVTitkrsgedptpqsccs
ippavsnagvkvipenakidsdneqTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLLAARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIPQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLEStvgihptlaeeftrvtitkrsgedptpqsccs
IPPAVSNAGVKVIPENAKIDSDNEQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLLAARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIPQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHPTLAEEFTRVTITKRSGEDPTPQSCCS
**************************NIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLLAARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIPQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHPTLAEEFTRVTI***************
IPPAVSNAGVKVIPENAKIDSDNEQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLLAARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIPQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHPTLAEEFTRVTIT******P*PQSCC*
IPPAVSNAGVKVIPENAKIDSDNEQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLLAARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIPQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHPTLAEEFTRVTITK*************
IPPAVSNAGVKVIPENAKIDSDNEQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLLAARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIPQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHPTLAEEFTRVTITKRS***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IPPAVSNAGVKVIPENAKIDSDNEQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLLAARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIPQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHPTLAEEFTRVTITKRSGEDPTPQSCCS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query212 2.2.26 [Sep-21-2011]
P91938596 Thioredoxin reductase 1, no N/A 0.915 0.325 0.626 7e-70
Q9VNT5516 Thioredoxin reductase 2, no N/A 0.910 0.374 0.604 1e-68
Q9JLT4524 Thioredoxin reductase 2, yes N/A 0.919 0.372 0.526 2e-60
Q9Z0J5526 Thioredoxin reductase 2, yes N/A 0.919 0.370 0.526 4e-60
Q9N2I8511 Thioredoxin reductase 2, yes N/A 0.919 0.381 0.531 2e-59
O89049499 Thioredoxin reductase 1, no N/A 0.924 0.392 0.519 6e-59
Q9NNW7524 Thioredoxin reductase 2, yes N/A 0.919 0.372 0.507 5e-58
Q9JMH6613 Thioredoxin reductase 1, no N/A 0.924 0.319 0.509 6e-58
O62768499 Thioredoxin reductase 1, no N/A 0.924 0.392 0.524 8e-58
Q9MYY8499 Thioredoxin reductase 1, no N/A 0.924 0.392 0.509 2e-57
>sp|P91938|TRXR1_DROME Thioredoxin reductase 1, mitochondrial OS=Drosophila melanogaster GN=Trxr-1 PE=1 SV=2 Back     alignment and function desciption
 Score =  263 bits (672), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 129/206 (62%), Positives = 156/206 (75%), Gaps = 12/206 (5%)

Query: 7   NAGVKVIPENAKIDSDNEQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLL 66
           NAGV V  +   +DS  E TN+ N++AVGD+++            KPELTPVAV AG+LL
Sbjct: 403 NAGVTVQKDKIPVDS-QEATNVANIYAVGDIIY-----------GKPELTPVAVLAGRLL 450

Query: 67  AARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFI 126
           A RLYG  T +MDY++VATTVFTPLEY CVGLSEE A + +GAD +E++H YYKPTEFFI
Sbjct: 451 ARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFI 510

Query: 127 PQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHP 186
           PQ++ + CYLK V ER   Q+V G+H+IGP AGEVIQG+AAA+K GLT  TL +TVGIHP
Sbjct: 511 PQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHP 570

Query: 187 TLAEEFTRVTITKRSGEDPTPQSCCS 212
           T AEEFTR+ ITKRSG DPTP SCCS
Sbjct: 571 TTAEEFTRLAITKRSGLDPTPASCCS 596
Thioredoxin system is a major player in glutathione metabolism, due to the demonstrated absence of a glutathione reductase. Functionally interacts with the Sod/Cat reactive oxidation species (ROS) defense system and thereby has a role in preadult development and life span. Lack of a glutathione reductase suggests antioxidant defense in Drosophila, and probably in related insects, differs fundamentally from that in other organisms.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 8EC: .EC: 1EC: .EC: 9
>sp|Q9VNT5|TRXR2_DROME Thioredoxin reductase 2, mitochondrial OS=Drosophila melanogaster GN=Trxr-2 PE=2 SV=1 Back     alignment and function description
>sp|Q9JLT4|TRXR2_MOUSE Thioredoxin reductase 2, mitochondrial OS=Mus musculus GN=Txnrd2 PE=1 SV=4 Back     alignment and function description
>sp|Q9Z0J5|TRXR2_RAT Thioredoxin reductase 2, mitochondrial OS=Rattus norvegicus GN=Txnrd2 PE=1 SV=3 Back     alignment and function description
>sp|Q9N2I8|TRXR2_BOVIN Thioredoxin reductase 2, mitochondrial OS=Bos taurus GN=TXNRD2 PE=1 SV=2 Back     alignment and function description
>sp|O89049|TRXR1_RAT Thioredoxin reductase 1, cytoplasmic OS=Rattus norvegicus GN=Txnrd1 PE=1 SV=5 Back     alignment and function description
>sp|Q9NNW7|TRXR2_HUMAN Thioredoxin reductase 2, mitochondrial OS=Homo sapiens GN=TXNRD2 PE=1 SV=3 Back     alignment and function description
>sp|Q9JMH6|TRXR1_MOUSE Thioredoxin reductase 1, cytoplasmic OS=Mus musculus GN=Txnrd1 PE=1 SV=3 Back     alignment and function description
>sp|O62768|TRXR1_BOVIN Thioredoxin reductase 1, cytoplasmic OS=Bos taurus GN=TXNRD1 PE=2 SV=3 Back     alignment and function description
>sp|Q9MYY8|TRXR1_PIG Thioredoxin reductase 1, cytoplasmic OS=Sus scrofa GN=TXNRD1 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query212
322785872 545 hypothetical protein SINV_11881 [Solenop 0.919 0.357 0.713 5e-83
332030506 840 Thioredoxin reductase 1, mitochondrial [ 0.919 0.232 0.684 3e-82
345486120 494 PREDICTED: thioredoxin reductase 2, mito 0.929 0.398 0.706 7e-82
345486118 492 PREDICTED: thioredoxin reductase 2, mito 0.929 0.400 0.706 8e-82
295842222 537 thioredoxin reductase 1 isoform 1 [Apis 0.919 0.363 0.689 1e-80
340719043 539 PREDICTED: thioredoxin reductase 1, mito 0.919 0.361 0.694 1e-80
33089108 485 thioredoxin reductase [Apis mellifera li 0.919 0.402 0.689 2e-80
296937023 494 thioredoxin reductase 1 [Apis cerana cer 0.919 0.394 0.689 2e-80
295842224 494 thioredoxin reductase 1 isoform 2 [Apis 0.919 0.394 0.689 2e-80
383854008 514 PREDICTED: thioredoxin reductase 1, mito 0.919 0.379 0.684 5e-80
>gi|322785872|gb|EFZ12491.1| hypothetical protein SINV_11881 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 170/206 (82%), Gaps = 11/206 (5%)

Query: 7   NAGVKVIPENAKIDSDNEQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLL 66
           NAG+K++PE  KID+ NEQTN+PN++AVGDVLH           +KPELTPVA+ AGKLL
Sbjct: 351 NAGLKLVPETGKIDAVNEQTNVPNIYAVGDVLH-----------KKPELTPVAIHAGKLL 399

Query: 67  AARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFI 126
           A RL+GN T +MDY NVATTVFTPLEYGCVGLSEE A EL+G D +EI+HAYYKPTEFF+
Sbjct: 400 AKRLFGNSTDKMDYTNVATTVFTPLEYGCVGLSEEAAVELHGEDQIEIFHAYYKPTEFFV 459

Query: 127 PQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHP 186
           PQ+N  RCY+KVV  R   +KVLGMHFIGPNAGEVIQG+AAA+KCGLT   L+STVGIHP
Sbjct: 460 PQKNVDRCYVKVVALRHHDEKVLGMHFIGPNAGEVIQGFAAAIKCGLTIPLLKSTVGIHP 519

Query: 187 TLAEEFTRVTITKRSGEDPTPQSCCS 212
           T+AEEFTR+ ITKRSG DP PQSCCS
Sbjct: 520 TVAEEFTRIFITKRSGMDPKPQSCCS 545

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332030506|gb|EGI70194.1| Thioredoxin reductase 1, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345486120|ref|XP_003425406.1| PREDICTED: thioredoxin reductase 2, mitochondrial-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345486118|ref|XP_001603220.2| PREDICTED: thioredoxin reductase 2, mitochondrial-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|295842222|ref|NP_001171496.1| thioredoxin reductase 1 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|340719043|ref|XP_003397967.1| PREDICTED: thioredoxin reductase 1, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|33089108|gb|AAP93583.1| thioredoxin reductase [Apis mellifera ligustica] Back     alignment and taxonomy information
>gi|296937023|gb|ADH94550.1| thioredoxin reductase 1 [Apis cerana cerana] gi|296937025|gb|ADH94551.1| thioredoxin reductase 1 [Apis cerana cerana] Back     alignment and taxonomy information
>gi|295842224|ref|NP_001171497.1| thioredoxin reductase 1 isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|383854008|ref|XP_003702514.1| PREDICTED: thioredoxin reductase 1, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query212
FB|FBgn0020653596 Trxr-1 "Thioredoxin reductase- 0.915 0.325 0.626 1.4e-64
FB|FBgn0037170516 Trxr-2 "thioredoxin reductase 0.910 0.374 0.604 5.4e-63
UNIPROTKB|F1P2T4499 TXNRD2 "Uncharacterized protei 0.919 0.390 0.545 1.5e-58
UNIPROTKB|F1P4U5529 TXNRD2 "Uncharacterized protei 0.919 0.368 0.545 1.5e-58
ZFIN|ZDB-GENE-040914-66503 si:ch1073-179p4.3 "si:ch1073-1 0.919 0.387 0.555 5.1e-58
ZFIN|ZDB-GENE-081104-217206 txnrd2 "thioredoxin reductase 0.919 0.946 0.555 5.1e-58
MGI|MGI:1347023524 Txnrd2 "thioredoxin reductase 0.919 0.372 0.526 1.2e-56
RGD|61960526 Txnrd2 "thioredoxin reductase 0.919 0.370 0.526 2.5e-56
UNIPROTKB|Q9Z0J5526 Txnrd2 "Thioredoxin reductase 0.919 0.370 0.526 2.5e-56
UNIPROTKB|F1SG38499 TXNRD1 "Thioredoxin reductase 0.919 0.390 0.531 1.4e-55
FB|FBgn0020653 Trxr-1 "Thioredoxin reductase-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 658 (236.7 bits), Expect = 1.4e-64, P = 1.4e-64
 Identities = 129/206 (62%), Positives = 156/206 (75%)

Query:     7 NAGVKVIPENAKIDSDNEQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLL 66
             NAGV V  +   +DS  E TN+ N++AVGD+++            KPELTPVAV AG+LL
Sbjct:   403 NAGVTVQKDKIPVDSQ-EATNVANIYAVGDIIY-----------GKPELTPVAVLAGRLL 450

Query:    67 AARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFI 126
             A RLYG  T +MDY++VATTVFTPLEY CVGLSEE A + +GAD +E++H YYKPTEFFI
Sbjct:   451 ARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFI 510

Query:   127 PQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHP 186
             PQ++ + CYLK V ER   Q+V G+H+IGP AGEVIQG+AAA+K GLT  TL +TVGIHP
Sbjct:   511 PQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHP 570

Query:   187 TLAEEFTRVTITKRSGEDPTPQSCCS 212
             T AEEFTR+ ITKRSG DPTP SCCS
Sbjct:   571 TTAEEFTRLAITKRSGLDPTPASCCS 596
GO:0001666 "response to hypoxia" evidence=IMP
GO:0004362 "glutathione-disulfide reductase activity" evidence=IDA;NAS;IMP
GO:0008340 "determination of adult lifespan" evidence=IMP;TAS
GO:0005737 "cytoplasm" evidence=IDA;NAS
GO:0004791 "thioredoxin-disulfide reductase activity" evidence=ISS;IDA
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0045454 "cell redox homeostasis" evidence=IEA;IC
GO:0005739 "mitochondrion" evidence=IDA
GO:0016209 "antioxidant activity" evidence=NAS;IDA
GO:0050661 "NADP binding" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0006974 "response to DNA damage stimulus" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
FB|FBgn0037170 Trxr-2 "thioredoxin reductase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2T4 TXNRD2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4U5 TXNRD2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040914-66 si:ch1073-179p4.3 "si:ch1073-179p4.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081104-217 txnrd2 "thioredoxin reductase 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1347023 Txnrd2 "thioredoxin reductase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61960 Txnrd2 "thioredoxin reductase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Z0J5 Txnrd2 "Thioredoxin reductase 2, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SG38 TXNRD1 "Thioredoxin reductase 1, cytoplasmic" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9NNW7TRXR2_HUMAN1, ., 8, ., 1, ., 90.50720.91980.3721yesN/A
Q9Z0J5TRXR2_RAT1, ., 8, ., 1, ., 90.52650.91980.3707yesN/A
Q9N2I8TRXR2_BOVIN1, ., 8, ., 1, ., 90.53140.91980.3816yesN/A
Q9JLT4TRXR2_MOUSE1, ., 8, ., 1, ., 90.52650.91980.3721yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
TIGR01438484 TIGR01438, TGR, thioredoxin and glutathione reduct 5e-86
PTZ00052499 PTZ00052, PTZ00052, thioredoxin reductase; Provisi 3e-55
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validat 2e-54
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide re 2e-39
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide re 1e-38
PTZ00058561 PTZ00058, PTZ00058, glutathione reductase; Provisi 8e-37
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 1e-35
PLN02546558 PLN02546, PLN02546, glutathione reductase 9e-35
pfam02852110 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disu 6e-34
PLN02507499 PLN02507, PLN02507, glutathione reductase 2e-31
TIGR01350460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 2e-22
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide 3e-21
TIGR02053463 TIGR02053, MerA, mercuric reductase 4e-18
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 7e-18
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 6e-17
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase 2e-14
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase 1e-11
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 5e-11
PRK07846451 PRK07846, PRK07846, mycothione reductase; Reviewed 3e-10
PRK06912458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Va 1e-09
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 3e-09
PTZ00153659 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provi 5e-09
PRK14727479 PRK14727, PRK14727, putative mercuric reductase; P 4e-08
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 1e-07
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 2e-07
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide 6e-07
PRK13748561 PRK13748, PRK13748, putative mercuric reductase; P 7e-07
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide tr 1e-06
PRK14694468 PRK14694, PRK14694, putative mercuric reductase; P 2e-06
PRK07845466 PRK07845, PRK07845, flavoprotein disulfide reducta 2e-06
PRK08010441 PRK08010, PRK08010, pyridine nucleotide-disulfide 4e-06
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase 4e-06
PRK06115466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase 2e-05
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase 7e-04
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 0.003
>gnl|CDD|233412 TIGR01438, TGR, thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information 
 Score =  262 bits (670), Expect = 5e-86
 Identities = 110/207 (53%), Positives = 149/207 (71%), Gaps = 13/207 (6%)

Query: 7   NAGVKVIPENAKIDSDN-EQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKL 65
           N GVK+  +  KI +D  EQTN+P ++AVGD+L           ++KPELTPVA+QAG+L
Sbjct: 288 NVGVKINKKTGKIPADEEEQTNVPYIYAVGDIL-----------EDKPELTPVAIQAGRL 336

Query: 66  LAARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFF 125
           LA RL+   T   DY+NV TTVFTPLEYG  GLSEEKA E +G +N+E++H+Y+ P E+ 
Sbjct: 337 LAQRLFKGSTVICDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENVEVFHSYFWPLEWT 396

Query: 126 IPQR-NPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGI 184
           IP R N  +CY K+VC +   ++V+G H +GPNAGEV QG+AAA++CGLT + L++T+GI
Sbjct: 397 IPSRDNHNKCYAKLVCNKKENERVVGFHVVGPNAGEVTQGFAAALRCGLTKKDLDNTIGI 456

Query: 185 HPTLAEEFTRVTITKRSGEDPTPQSCC 211
           HP  AE FT +++TKRSG+D   Q CC
Sbjct: 457 HPVCAEVFTTLSVTKRSGQDILQQGCC 483

This homodimeric, FAD-containing member of the pyridine nucleotide disulfide oxidoreductase family contains a C-terminal motif Cys-SeCys-Gly, where SeCys is selenocysteine encoded by TGA (in some sequence reports interpreted as a stop codon). In some members of this subfamily, Cys-SeCys-Gly is replaced by Cys-Cys-Gly. The reach of the selenium atom at the C-term arm of the protein is proposed to allow broad substrate specificity. Length = 484
>gnl|CDD|185416 PTZ00052, PTZ00052, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|235701 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|213618 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215301 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|217252 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain Back     alignment and domain information
>gnl|CDD|215281 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|200098 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|233700 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235779 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|173442 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237806 PRK14727, PRK14727, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237790 PRK14694, PRK14694, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|236112 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|181196 PRK08010, PRK08010, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|236106 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 212
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 100.0
PRK14727479 putative mercuric reductase; Provisional 100.0
PRK14694468 putative mercuric reductase; Provisional 100.0
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 100.0
TIGR02053463 MerA mercuric reductase. This model represents the 100.0
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 100.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 100.0
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 100.0
PLN02507499 glutathione reductase 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PRK06116450 glutathione reductase; Validated 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 100.0
PRK06370463 mercuric reductase; Validated 100.0
PLN02546558 glutathione reductase 100.0
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 100.0
PRK07846451 mycothione reductase; Reviewed 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 100.0
PRK07845466 flavoprotein disulfide reductase; Reviewed 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
KOG4716|consensus503 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 100.0
PTZ00153659 lipoamide dehydrogenase; Provisional 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 100.0
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
KOG1335|consensus506 100.0
PTZ00058561 glutathione reductase; Provisional 100.0
PTZ00052499 thioredoxin reductase; Provisional 100.0
PRK05976472 dihydrolipoamide dehydrogenase; Validated 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 99.97
KOG0405|consensus478 99.97
PRK09564444 coenzyme A disulfide reductase; Reviewed 99.97
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.97
PF02852110 Pyr_redox_dim: Pyridine nucleotide-disulphide oxid 99.92
PRK14989 847 nitrite reductase subunit NirD; Provisional 99.74
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.55
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.48
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 99.48
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.29
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.92
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.91
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.86
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.71
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.66
KOG1336|consensus478 98.51
PRK12770352 putative glutamate synthase subunit beta; Provisio 98.5
PRK12831464 putative oxidoreductase; Provisional 98.48
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.48
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 98.48
PRK098531019 putative selenate reductase subunit YgfK; Provisio 98.44
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.43
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 98.42
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.41
PRK12814652 putative NADPH-dependent glutamate synthase small 98.39
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 98.39
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 98.35
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.33
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 98.32
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.3
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.29
KOG2495|consensus491 98.2
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.2
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.11
PRK10262321 thioredoxin reductase; Provisional 98.1
PRK12771564 putative glutamate synthase (NADPH) small subunit; 98.09
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.05
PRK13984604 putative oxidoreductase; Provisional 98.03
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.98
KOG1346|consensus659 97.95
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 97.43
PLN02852491 ferredoxin-NADP+ reductase 97.39
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 96.66
KOG0404|consensus322 96.58
KOG3851|consensus446 95.94
PRK08275554 putative oxidoreductase; Provisional 95.94
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 95.89
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 95.87
PRK07804541 L-aspartate oxidase; Provisional 95.3
KOG0399|consensus2142 95.06
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 95.06
PRK08071510 L-aspartate oxidase; Provisional 94.71
PRK09231582 fumarate reductase flavoprotein subunit; Validated 94.55
PRK09077536 L-aspartate oxidase; Provisional 94.23
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 94.1
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 94.02
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 94.01
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 93.77
PRK08401466 L-aspartate oxidase; Provisional 93.56
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 93.54
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 93.53
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 93.47
PRK07512513 L-aspartate oxidase; Provisional 93.04
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 92.98
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 92.85
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 92.85
PRK06175433 L-aspartate oxidase; Provisional 92.56
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 92.17
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 91.78
PRK08626657 fumarate reductase flavoprotein subunit; Provision 91.65
PRK07395553 L-aspartate oxidase; Provisional 90.74
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 90.4
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 89.8
PLN02815594 L-aspartate oxidase 89.59
TIGR01816565 sdhA_forward succinate dehydrogenase, flavoprotein 89.47
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 88.54
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 88.23
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 87.77
PRK08274466 tricarballylate dehydrogenase; Validated 87.55
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 86.94
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 86.3
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 86.16
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 84.24
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 84.01
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-38  Score=285.60  Aligned_cols=177  Identities=32%  Similarity=0.530  Sum_probs=163.4

Q ss_pred             ccccccCCeeccCCCceecCCCC-CCCCCeEEcCccCCCCCCCCCCCCCCCCchhHHHHHHHHHHHHHHhCCCCcCCCcc
Q psy11186          3 PAVSNAGVKVIPENAKIDSDNEQ-TNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLLAARLYGNGTTQMDYQ   81 (212)
Q Consensus         3 ~~l~~~gl~~~~~~G~I~Vd~~l-Ts~p~IyA~GD~a~~~~~~~~~~~~~~~~l~~~A~~~g~~aa~nl~g~~~~~~~~~   81 (212)
                      ++|+++||+++ ++|+|+||++| ||.|+|||+|||+            +.++|+|.|.+||++||+|++|......++.
T Consensus       277 LgLe~~Gv~~~-~rg~I~VD~~~~Tnvp~IyA~GDV~------------~~~~Lah~A~~eg~iaa~~i~g~~~~~~d~~  343 (454)
T COG1249         277 LGLENAGVELD-DRGFIKVDDQMTTNVPGIYAIGDVI------------GGPMLAHVAMAEGRIAAENIAGGKRTPIDYR  343 (454)
T ss_pred             CChhhcCceEC-CCCCEEeCCccccCCCCEEEeeccC------------CCcccHhHHHHHHHHHHHHHhCCCCCcCccc
Confidence            67999999999 78999999778 8899999999999            6777999999999999999998555567899


Q ss_pred             cceeEEEcCCceeeecCCHHHHHHhhCCCCEEEEEEeeccccccccCCCCCceEEEEEEecCCCCeEEEEEEECccHHHH
Q psy11186         82 NVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIPQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEV  161 (212)
Q Consensus        82 ~~~~~~~~~~~ia~vGlt~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~klv~d~~~~g~ilGa~~vg~~a~~~  161 (212)
                      .+|+++|++|++++||+||+||+++++  ++++...+|....++..... ..||+|+++| +++++|||+|++|++|.|+
T Consensus       344 ~iP~~ift~Peia~VGlte~ea~~~g~--~~~~~~~~f~~~~ra~~~~~-~~G~~Klv~d-~~t~~IlGahivg~~A~El  419 (454)
T COG1249         344 LIPSVVFTDPEIASVGLTEEEAKEAGI--DYKVGKFPFAANGRAITMGE-TDGFVKLVVD-KETGRILGAHIVGPGASEL  419 (454)
T ss_pred             CCCEEEECCCcceeeeCCHHHHHhcCC--ceEEEEeecccchhHHhccC-CceEEEEEEE-CCCCeEEEEEEECCCHHHH
Confidence            999999999999999999999999875  58888889998888877654 7999999999 8999999999999999999


Q ss_pred             HHHHHHHHHCCCCHHHHhhcccCCCCchhhHHHHH
Q psy11186        162 IQGYAAAVKCGLTFETLESTVGIHPTLAEEFTRVT  196 (212)
Q Consensus       162 i~~~~~ai~~~~t~~~l~~~~~~~P~~~e~~~~~~  196 (212)
                      |+.++++|+++++++++.+.+++|||++|.+..++
T Consensus       420 I~~~~~a~~~g~t~~~~~~~i~~HPT~sE~~~~a~  454 (454)
T COG1249         420 INEIALAIEMGATAEDLALTIHAHPTLSEALKEAA  454 (454)
T ss_pred             HHHHHHHHHCCCcHHHHhcCCCCCCChHHHHHHhC
Confidence            99999999999999999999999999999998763

>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PF02852 Pyr_redox_dim: Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; InterPro: IPR004099 This entry represents a dimerisation domain that is usually found at the C-terminal of both class I and class II oxidoreductases, as well as in NADH oxidases and peroxidases [, , ] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
2nvk_X488 Crystal Structure Of Thioredoxin Reductase From Dro 1e-68
3dh9_A482 Crystal Structure Of Drosophila Thioredoxin Reducta 4e-68
3dgh_A483 Crystal Structure Of Drosophila Thioredoxin Reducta 4e-66
1zdl_A517 Crystal Structure Of Mouse Thioredoxin Reductase Ty 1e-62
1h6v_A499 Mammalian Thioredoxin Reductase Length = 499 5e-61
3dgz_A488 Crystal Structure Of Mouse Mitochondrial Thioredoxi 7e-61
3ean_A499 Crystal Structure Of Recombinant Rat Selenoprotein 5e-60
2zz0_A513 Crystal Structure Of Human Thioredoxin Reductase I 2e-59
2j3n_A519 X-Ray Structure Of Human Thioredoxin Reductase 1 Le 2e-59
2cfy_A521 Crystal Structure Of Human Thioredoxin Reductase 1 2e-58
3qfa_A519 Crystal Structure Of The Human Thioredoxin Reductas 2e-58
2x8c_A598 Thioredoxin Glutathione Reductase From Schistosoma 8e-54
3h4k_A598 Crystal Structure Of The Wild Type Thioredoxin Glut 9e-53
2v6o_A596 Structure Of Schistosoma Mansoni Thioredoxin-Glutat 1e-52
4b1b_A542 Crystal Structure Of Plasmodium Falciparum Oxidised 6e-35
2hqm_A479 Crystal Structure Of Glutathione Reductase Glr1 Fro 4e-29
1onf_A500 Crystal Structure Of Plasmodium Falciparum Glutathi 3e-27
2r9z_A463 Glutathione Amide Reductase From Chromatium Gracile 5e-27
1ger_A450 The Structure Of Glutathione Reductase From Escheri 2e-25
1ges_A450 Anatomy Of An Engineered Nad-Binding Site Length = 3e-25
2aaq_A479 Crystal Structure Analysis Of The Human Glutahione 7e-25
1grg_A478 Substrate Binding And Catalysis By Glutathione Redu 7e-25
1dnc_A478 Human Glutathione Reductase Modified By Diglutathio 7e-25
1k4q_A463 Human Glutathione Reductase Inactivated By Peroxyni 8e-25
1xan_A461 Human Glutathione Reductase In Complex With A Xanth 8e-25
3djg_X477 Catalytic Cycle Of Human Glutathione Reductase Near 8e-25
1bwc_A478 Structure Of Human Glutathione Reductase Complexed 8e-25
1grt_A478 Human Glutathione Reductase A34eR37W MUTANT Length 9e-25
2grt_A461 Human Glutathione Reductase A34e, R37w Mutant, Oxid 1e-24
1gsn_A478 Human Glutathione Reductase Modified By Dinitrosogl 2e-23
3o0h_A484 Crystal Structure Of Glutathione Reductase From Bar 1e-20
2wba_A492 Properties Of Trypanothione Reductase From T. Bruce 2e-18
2woi_A495 Trypanothione Reductase From Trypanosoma Brucei Len 2e-18
4dna_A463 Crystal Structure Of Putative Glutathione Reductase 2e-18
1typ_A487 Substrate Interactions Between Trypanothione Reduct 2e-17
1tyt_A487 Crystal And Molecular Structure Of Crithidia Fascic 2e-17
2tpr_A490 X-ray Structure Of Trypanothione Reductase From Cri 2e-17
1fea_A490 Unliganded Crithidia Fasciculata Trypanothione Redu 3e-17
1nda_A491 The Structure Of Trypanosoma Cruzi Trypanothione Re 9e-17
1gxf_A492 Crystal Structure Of Trypanosoma Cruzi Trypanothion 2e-16
1aog_A485 Trypanosoma Cruzi Trypanothione Reductase (Oxidized 2e-16
1bzl_A486 Crystal Structure Of Trypanosoma Cruzi Trypanothion 2e-16
2x50_A510 Crystal Structure Of Trypanothione Reductase From L 9e-16
2jk6_A511 Structure Of Trypanothione Reductase From Leishmani 9e-16
1zy8_A474 The Crystal Structure Of Dihydrolipoamide Dehydroge 3e-11
1zmc_A474 Crystal Structure Of Human Dihydrolipoamide Dehydro 3e-11
3rnm_A495 The Crystal Structure Of The Subunit Binding Of Hum 3e-11
1lpf_A477 Three-Dimensional Structure Of Lipoamide Dehydrogen 4e-11
3lad_A476 Refined Crystal Structure Of Lipoamide Dehydrogenas 7e-10
1ebd_A455 Dihydrolipoamide Dehydrogenase Complexed With The B 1e-09
1dxl_A470 Dihydrolipoamide Dehydrogenase Of Glycine Decarboxy 1e-09
2eq6_A464 Crystal Structure Of Lipoamide Dehydrogenase From T 3e-09
1jeh_A478 Crystal Structure Of Yeast E3, Lipoamide Dehydrogen 5e-09
3urh_A491 Crystal Structure Of A Dihydrolipoamide Dehydrogena 1e-07
3l8k_A466 Crystal Structure Of A Dihydrolipoyl Dehydrogenase 5e-07
2qae_A468 Crystal Structure Analysis Of Trypanosoma Cruzi Lip 5e-07
2eq7_A455 Crystal Structure Of Lipoamide Dehydrogenase From T 2e-06
1zk7_A467 Crystal Structure Of Tn501 Mera Length = 467 8e-06
>pdb|2NVK|X Chain X, Crystal Structure Of Thioredoxin Reductase From Drosophila Melanogaster Length = 488 Back     alignment and structure 
Iteration: 1

 Score =  255 bits (651), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 153/203 (75%), Gaps = 12/203 (5%)
Query: 7   NAGVKVIPENAKIDSDNEQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLL 66
           NAGV V  +   +DS  E TN+ N++AVGD+++            KPELTPVAV AG+LL
Sbjct: 298 NAGVTVQKDKIPVDS-QEATNVANIYAVGDIIY-----------GKPELTPVAVLAGRLL 345
Query: 67  AARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFI 126
           A RLYG  T +MDY++VATTVFTPLEY CVGLSEE A + +GAD +E++H YYKPTEFFI
Sbjct: 346 ARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFI 405
Query: 127 PQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHP 186
           PQ++ + CYLK V ER   Q+V G+H+IGP AGEVIQG+AAA+K GLT  TL +TVGIHP
Sbjct: 406 PQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHP 465
Query: 187 TLAEEFTRVTITKRSGEDPTPQS 209
           T AEEFTR+ ITKRSG DPTP S
Sbjct: 466 TTAEEFTRLAITKRSGLDPTPAS 488
>pdb|3DH9|A Chain A, Crystal Structure Of Drosophila Thioredoxin Reductase, Wild-Type Length = 482 Back     alignment and structure
>pdb|3DGH|A Chain A, Crystal Structure Of Drosophila Thioredoxin Reductase, C-Terminal 8- Residue Truncation Length = 483 Back     alignment and structure
>pdb|1ZDL|A Chain A, Crystal Structure Of Mouse Thioredoxin Reductase Type 2 Length = 517 Back     alignment and structure
>pdb|1H6V|A Chain A, Mammalian Thioredoxin Reductase Length = 499 Back     alignment and structure
>pdb|3DGZ|A Chain A, Crystal Structure Of Mouse Mitochondrial Thioredoxin Reductase, C- Terminal 3-Residue Truncation Length = 488 Back     alignment and structure
>pdb|3EAN|A Chain A, Crystal Structure Of Recombinant Rat Selenoprotein Thioredoxin Reductase 1 With Reduced C-Terminal Tail Length = 499 Back     alignment and structure
>pdb|2ZZ0|A Chain A, Crystal Structure Of Human Thioredoxin Reductase I (Secys 498 Cys) Length = 513 Back     alignment and structure
>pdb|2J3N|A Chain A, X-Ray Structure Of Human Thioredoxin Reductase 1 Length = 519 Back     alignment and structure
>pdb|2CFY|A Chain A, Crystal Structure Of Human Thioredoxin Reductase 1 Length = 521 Back     alignment and structure
>pdb|3QFA|A Chain A, Crystal Structure Of The Human Thioredoxin Reductase-Thioredoxin Complex Length = 519 Back     alignment and structure
>pdb|2X8C|A Chain A, Thioredoxin Glutathione Reductase From Schistosoma Mansoni With The Reduced C-Terminal End Length = 598 Back     alignment and structure
>pdb|3H4K|A Chain A, Crystal Structure Of The Wild Type Thioredoxin Glutatione Reductase From Schistosoma Mansoni In Complex With Auranofin Length = 598 Back     alignment and structure
>pdb|2V6O|A Chain A, Structure Of Schistosoma Mansoni Thioredoxin-Glutathione Reductase (Smtgr) Length = 596 Back     alignment and structure
>pdb|4B1B|A Chain A, Crystal Structure Of Plasmodium Falciparum Oxidised Thioredoxin Reductase At 2.9 Angstrom Length = 542 Back     alignment and structure
>pdb|2HQM|A Chain A, Crystal Structure Of Glutathione Reductase Glr1 From The Yeast Saccharomyces Cerevisiae Length = 479 Back     alignment and structure
>pdb|1ONF|A Chain A, Crystal Structure Of Plasmodium Falciparum Glutathione Reductase Length = 500 Back     alignment and structure
>pdb|2R9Z|A Chain A, Glutathione Amide Reductase From Chromatium Gracile Length = 463 Back     alignment and structure
>pdb|1GER|A Chain A, The Structure Of Glutathione Reductase From Escherichia Coli At 1.86 Angstroms Resolution: Comparison With The Enzyme From Human Erythrocytes Length = 450 Back     alignment and structure
>pdb|1GES|A Chain A, Anatomy Of An Engineered Nad-Binding Site Length = 450 Back     alignment and structure
>pdb|2AAQ|A Chain A, Crystal Structure Analysis Of The Human Glutahione Reductase, Complexed With Gopi Length = 479 Back     alignment and structure
>pdb|1GRG|A Chain A, Substrate Binding And Catalysis By Glutathione Reductase As Derived From Refined Enzyme: Substrate Crystal Structures At 2 Angstroms Resolution Length = 478 Back     alignment and structure
>pdb|1DNC|A Chain A, Human Glutathione Reductase Modified By Diglutathione-Dinitroso-Iron Length = 478 Back     alignment and structure
>pdb|1XAN|A Chain A, Human Glutathione Reductase In Complex With A Xanthene Inhibitor Length = 461 Back     alignment and structure
>pdb|3DJG|X Chain X, Catalytic Cycle Of Human Glutathione Reductase Near 1 A Resolution Length = 477 Back     alignment and structure
>pdb|1BWC|A Chain A, Structure Of Human Glutathione Reductase Complexed With Ajoene Inhibitor And Subversive Substrate Length = 478 Back     alignment and structure
>pdb|1GRT|A Chain A, Human Glutathione Reductase A34eR37W MUTANT Length = 478 Back     alignment and structure
>pdb|2GRT|A Chain A, Human Glutathione Reductase A34e, R37w Mutant, Oxidized Glutathione Complex Length = 461 Back     alignment and structure
>pdb|1GSN|A Chain A, Human Glutathione Reductase Modified By Dinitrosoglutathione Length = 478 Back     alignment and structure
>pdb|3O0H|A Chain A, Crystal Structure Of Glutathione Reductase From Bartonella Henselae Length = 484 Back     alignment and structure
>pdb|2WBA|A Chain A, Properties Of Trypanothione Reductase From T. Brucei Length = 492 Back     alignment and structure
>pdb|2WOI|A Chain A, Trypanothione Reductase From Trypanosoma Brucei Length = 495 Back     alignment and structure
>pdb|4DNA|A Chain A, Crystal Structure Of Putative Glutathione Reductase From Sinorhizobium Meliloti 1021 Length = 463 Back     alignment and structure
>pdb|1TYP|A Chain A, Substrate Interactions Between Trypanothione Reductase And N1-Glutathionylspermidine Disulphide At 0.28-Nm Resolution Length = 487 Back     alignment and structure
>pdb|1TYT|A Chain A, Crystal And Molecular Structure Of Crithidia Fasciculata Trypanothione Reductase At 2.6 Angstroms Resolution Length = 487 Back     alignment and structure
>pdb|2TPR|A Chain A, X-ray Structure Of Trypanothione Reductase From Crithidia Fasciculata At 2.4 Angstroms Resolution Length = 490 Back     alignment and structure
>pdb|1FEA|A Chain A, Unliganded Crithidia Fasciculata Trypanothione Reductase At 2.2 Angstrom Resolution Length = 490 Back     alignment and structure
>pdb|1NDA|A Chain A, The Structure Of Trypanosoma Cruzi Trypanothione Reductase In The Oxidized And Nadph Reduced State Length = 491 Back     alignment and structure
>pdb|1GXF|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With The Inhibitor Quinacrine Mustard Length = 492 Back     alignment and structure
>pdb|1AOG|A Chain A, Trypanosoma Cruzi Trypanothione Reductase (Oxidized Form) Length = 485 Back     alignment and structure
>pdb|1BZL|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With Trypanothione, And The Structure- Based Discovery Of New Natural Product Inhibitors Length = 486 Back     alignment and structure
>pdb|2X50|A Chain A, Crystal Structure Of Trypanothione Reductase From Leishmania Infantum In Complex With Nadph And Silver Length = 510 Back     alignment and structure
>pdb|2JK6|A Chain A, Structure Of Trypanothione Reductase From Leishmania Infantum Length = 511 Back     alignment and structure
>pdb|1ZY8|A Chain A, The Crystal Structure Of Dihydrolipoamide Dehydrogenase And Dihydrolipoamide Dehydrogenase-Binding Protein (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase Complex. Length = 474 Back     alignment and structure
>pdb|1ZMC|A Chain A, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase Complexed To Nad+ Length = 474 Back     alignment and structure
>pdb|3RNM|A Chain A, The Crystal Structure Of The Subunit Binding Of Human Dihydrolipoamide Transacylase (E2b) Bound To Human Dihydrolipoamide Dehydrogenase (E3) Length = 495 Back     alignment and structure
>pdb|1LPF|A Chain A, Three-Dimensional Structure Of Lipoamide Dehydrogenase From Pseudomonas Fluorescens At 2.8 Angstroms Resolution. Analysis Of Redox And Thermostability Properties Length = 477 Back     alignment and structure
>pdb|3LAD|A Chain A, Refined Crystal Structure Of Lipoamide Dehydrogenase From Azotobacter Vinelandii At 2.2 Angstroms Resolution. A Comparison With The Structure Of Glutathione Reductase Length = 476 Back     alignment and structure
>pdb|1EBD|A Chain A, Dihydrolipoamide Dehydrogenase Complexed With The Binding Domain Of The Dihydrolipoamide Acetylase Length = 455 Back     alignment and structure
>pdb|1DXL|A Chain A, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase From Pisum Sativum Length = 470 Back     alignment and structure
>pdb|2EQ6|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Thermus Thermophilus Hb8 Length = 464 Back     alignment and structure
>pdb|1JEH|A Chain A, Crystal Structure Of Yeast E3, Lipoamide Dehydrogenase Length = 478 Back     alignment and structure
>pdb|3URH|A Chain A, Crystal Structure Of A Dihydrolipoamide Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 491 Back     alignment and structure
>pdb|3L8K|A Chain A, Crystal Structure Of A Dihydrolipoyl Dehydrogenase From Sulfolobus Solfataricus Length = 466 Back     alignment and structure
>pdb|2QAE|A Chain A, Crystal Structure Analysis Of Trypanosoma Cruzi Lipoamide Dehydrogenase Length = 468 Back     alignment and structure
>pdb|2EQ7|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Thermus Thermophilus Hb8 With Psbdo Length = 455 Back     alignment and structure
>pdb|1ZK7|A Chain A, Crystal Structure Of Tn501 Mera Length = 467 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 1e-100
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 5e-98
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 3e-95
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 2e-93
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 1e-85
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 3e-85
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 2e-84
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 6e-83
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 3e-82
4dna_A463 Probable glutathione reductase; structural genomic 4e-82
1fec_A490 Trypanothione reductase; redox-active center, oxid 4e-82
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 6e-81
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 3e-67
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 3e-29
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 4e-21
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 1e-20
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 9e-19
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 2e-17
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 2e-16
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 9e-16
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 9e-15
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 3e-14
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 4e-14
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 5e-14
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 8e-14
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 9e-14
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 1e-13
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 2e-13
1ojt_A482 Surface protein; redox-active center, glycolysis, 3e-13
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 8e-13
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 5e-10
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 7e-10
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 5e-09
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 6e-09
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 6e-09
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 7e-09
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 9e-09
1yqz_A438 Coenzyme A disulfide reductase; oxidoreductase; HE 9e-09
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 9e-09
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 1e-08
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure
 Score =  299 bits (767), Expect = e-100
 Identities = 105/206 (50%), Positives = 140/206 (67%), Gaps = 12/206 (5%)

Query: 7   NAGVKVIPENAKIDSD-NEQTNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKL 65
             GVK+  +  KI     EQTN+P ++A+GD+L            +K ELTPVA+QAG+L
Sbjct: 324 TVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILE-----------DKVELTPVAIQAGRL 372

Query: 66  LAARLYGNGTTQMDYQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFF 125
           LA RLY   T + DY+NV TTVFTPLEYG  GLSEEKA E +G +N+E+YH+Y+ P E+ 
Sbjct: 373 LAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWT 432

Query: 126 IPQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIH 185
           IP R+  +CY K++C     ++V+G H +GPNAGEV QG+AAA+KCGLT + L+ST+GIH
Sbjct: 433 IPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIH 492

Query: 186 PTLAEEFTRVTITKRSGEDPTPQSCC 211
           P  AE FT +++TKRSG        C
Sbjct: 493 PVCAEVFTTLSVTKRSGASILQAGSC 518
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Length = 466 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Length = 478 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Length = 474 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Length = 490 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query212
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 100.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 100.0
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 100.0
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 100.0
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 100.0
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
4dna_A463 Probable glutathione reductase; structural genomic 100.0
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 100.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 100.0
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 100.0
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 100.0
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 100.0
1ojt_A482 Surface protein; redox-active center, glycolysis, 100.0
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 100.0
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 100.0
1fec_A490 Trypanothione reductase; redox-active center, oxid 100.0
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 100.0
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 100.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 100.0
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 100.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 100.0
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 100.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 100.0
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 100.0
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 100.0
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 100.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 100.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 100.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 100.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 100.0
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 100.0
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 99.98
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.97
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.97
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.97
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.97
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.97
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.97
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.97
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.97
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.96
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.8
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.72
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 99.69
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.64
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 99.64
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.55
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.54
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.54
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 99.21
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.09
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.03
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 98.98
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.89
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.89
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 98.85
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.84
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.79
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.78
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.78
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.78
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.76
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.75
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.74
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.74
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.73
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.69
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.69
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 98.63
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.62
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 98.59
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.57
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.55
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.55
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.45
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.44
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.37
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.33
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 98.1
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.05
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.94
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 97.78
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 97.52
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.34
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.11
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.08
2cul_A232 Glucose-inhibited division protein A-related PROT 96.46
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 96.43
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 96.37
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 95.99
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 95.68
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 95.34
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 94.59
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 93.77
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 93.35
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 92.84
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 92.47
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 91.92
2gqf_A401 Hypothetical protein HI0933; structural genomics, 90.85
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 87.6
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 86.36
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 81.49
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
Probab=100.00  E-value=2e-38  Score=291.09  Aligned_cols=198  Identities=39%  Similarity=0.691  Sum_probs=137.1

Q ss_pred             ccccccCCeeccCCCc-eecCCCC-CCCCCeEEcCccCCCCCCCCCCCCCCCCchhHHHHHHHHHHHHHHhCCCCcCCCc
Q psy11186          3 PAVSNAGVKVIPENAK-IDSDNEQ-TNIPNVFAVGDVLHFSPFPVLPLFQEKPELTPVAVQAGKLLAARLYGNGTTQMDY   80 (212)
Q Consensus         3 ~~l~~~gl~~~~~~G~-I~Vd~~l-Ts~p~IyA~GD~a~~~~~~~~~~~~~~~~l~~~A~~~g~~aa~nl~g~~~~~~~~   80 (212)
                      ++|+++|++++ ++|. |.||++| ||.|+|||+|||+.           +.|+|+|.|.+||+++++|++|......++
T Consensus       324 L~le~~gv~~~-~~~~~i~vd~~~~Ts~p~IyAiGDv~~-----------~~p~La~~A~~eg~~aa~~i~g~~~~~~d~  391 (542)
T 4b1b_A          324 LNLESLNMNVN-KSNNKIIADHLSCTNIPSIFAVGDVAE-----------NVPELAPVAIKAGEILARRLFKDSDEIMDY  391 (542)
T ss_dssp             GCGGGTTCCEE-TTTTEECCCTTSBCSSTTEEECTTSBT-----------TCCCCHHHHHHHHHHHHHHHHSCCCCCCCC
T ss_pred             cCcccceeeec-ccCceEeccccccccCCCeEEeccccC-----------CchhHHHHHHHHHHHHHHHHhcCCCcccCC
Confidence            46888999998 5555 5888999 99999999999994           457899999999999999999987777899


Q ss_pred             ccceeEEEcCCceeeecCCHHHHHHhhCCCCEEEEEEeecccccccc--------------CCCCCceEEEEEEecCCCC
Q psy11186         81 QNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIP--------------QRNPQRCYLKVVCERAAPQ  146 (212)
Q Consensus        81 ~~~~~~~~~~~~ia~vGlt~~~a~~~~~~~~~~~~~~~~~~~~~~~~--------------~~~~~~g~~klv~d~~~~g  146 (212)
                      ..+|+++|++|++++||+||+||++++++.++.++...+.+......              ....+.||+|+++..++++
T Consensus       392 ~~iP~~vft~PeiA~VGlTE~eA~~~g~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~vKli~~~~~t~  471 (542)
T 4b1b_A          392 SYIPTSIYTPIEYGACGYSEEKAYELYGKSNVEVFLQEFNNLEISAVHRQKHIRAQKDEYDLDVSSTCLAKLVCLKNEDN  471 (542)
T ss_dssp             SSCCEEECSSSCEEEEECCHHHHHHHHCTTTEEEEEC-----------------------------CCCEEEEEETTTTT
T ss_pred             CCCceEEeCCCCeEEEeCCHHHHHHhCCCCcEEEEEeeccchhhhhhhhhhhhhcccccccccCCCceEEEEEEEeCCCC
Confidence            99999999999999999999999999887778776555443322110              0013679999986316789


Q ss_pred             eEEEEEEECccHHHHHHHHHHHHHCCCCHHHHhhcccCCCCchhhHHHHHhhhhcCCCCCCCCCCC
Q psy11186        147 KVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHPTLAEEFTRVTITKRSGEDPTPQSCCS  212 (212)
Q Consensus       147 ~ilGa~~vg~~a~~~i~~~~~ai~~~~t~~~l~~~~~~~P~~~e~~~~~~~~~~~~~~~~~~~~~~  212 (212)
                      +|||+|++|++|.|+|+.+++||++++|+++|.+.+++|||++|.|.+++++.+...++.+.+||+
T Consensus       472 ~ILGa~ivG~~A~ElI~~~alAi~~~~t~~dl~~~i~~HPTlsE~l~~~~~t~~~g~~~~~~~~c~  537 (542)
T 4b1b_A          472 RVIGFHYVGPNAGEVTQGMALALRLKVKKKDFDNCIGIHPTDAESFMNLFVTISSGLSYAAKGGCG  537 (542)
T ss_dssp             BEEEEEEESTTHHHHHHHHHHHHHTCCBHHHHHHC-------------------------------
T ss_pred             EEEEEEEECCCHHHHHHHHHHHHHcCCCHHHHhccCCcCCCHHHHHHHHHHHHHcCCCHHHccCCC
Confidence            999999999999999999999999999999999999999999999999999987878999999995
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 212
d1h6va3133 d.87.1.1 (A:367-499) Mammalian thioredoxin reducta 2e-37
d1v59a3123 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenas 2e-24
d1onfa3119 d.87.1.1 (A:377-495) Glutathione reductase {Plasmo 7e-24
d1feca3128 d.87.1.1 (A:358-485) Trypanothione reductase {Crit 7e-24
d3lada3124 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenas 7e-24
d1gesa3115 d.87.1.1 (A:336-450) Glutathione reductase {Escher 1e-23
d3grsa3115 d.87.1.1 (A:364-478) Glutathione reductase {Human 1e-22
d1dxla3123 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenas 2e-21
d1mo9a3140 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl c 1e-20
d1ojta3128 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenas 4e-19
d1xdia2118 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenas 5e-19
d1ebda3115 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenas 5e-19
d1lvla3123 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenas 1e-17
d1nhpa3126 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus 4e-15
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 9e-13
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 1e-10
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 1e-09
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 2e-08
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 6e-07
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 9e-07
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 1e-06
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 2e-06
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 6e-06
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 1e-05
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 3e-05
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 3e-05
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 4e-04
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 7e-04
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 8e-04
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 8e-04
>d1h6va3 d.87.1.1 (A:367-499) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: CO dehydrogenase flavoprotein C-domain-like
superfamily: FAD/NAD-linked reductases, dimerisation (C-terminal) domain
family: FAD/NAD-linked reductases, dimerisation (C-terminal) domain
domain: Mammalian thioredoxin reductase
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  124 bits (313), Expect = 2e-37
 Identities = 75/132 (56%), Positives = 99/132 (75%)

Query: 80  YQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIPQRNPQRCYLKVV 139
           Y NV TTVFTPLEYGC GLSEEKA E +G +N+E+YH+++ P E+ +P R+  +CY KV+
Sbjct: 1   YDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNNKCYAKVI 60

Query: 140 CERAAPQKVLGMHFIGPNAGEVIQGYAAAVKCGLTFETLESTVGIHPTLAEEFTRVTITK 199
           C     ++V+G H +GPNAGEV QG+AAA+KCGLT + L+ST+GIHP  AE FT +++TK
Sbjct: 61  CNLKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTK 120

Query: 200 RSGEDPTPQSCC 211
           RSG D     CC
Sbjct: 121 RSGGDILQSGCC 132
>d1v59a3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 123 Back     information, alignment and structure
>d1onfa3 d.87.1.1 (A:377-495) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 119 Back     information, alignment and structure
>d1feca3 d.87.1.1 (A:358-485) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 128 Back     information, alignment and structure
>d3lada3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 124 Back     information, alignment and structure
>d1gesa3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d3grsa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1dxla3 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 123 Back     information, alignment and structure
>d1mo9a3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 140 Back     information, alignment and structure
>d1ojta3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 128 Back     information, alignment and structure
>d1xdia2 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 118 Back     information, alignment and structure
>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 115 Back     information, alignment and structure
>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 123 Back     information, alignment and structure
>d1nhpa3 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 126 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query212
d1h6va3133 Mammalian thioredoxin reductase {Rat (Rattus norve 99.96
d1v59a3123 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.95
d3lada3124 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.95
d1dxla3123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.95
d1ojta3128 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.94
d1lvla3123 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.94
d3grsa3115 Glutathione reductase {Human (Homo sapiens) [TaxId 99.94
d1gesa3115 Glutathione reductase {Escherichia coli [TaxId: 56 99.94
d1xdia2118 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.94
d1ebda3115 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.94
d1onfa3119 Glutathione reductase {Plasmodium falciparum [TaxI 99.93
d1feca3128 Trypanothione reductase {Crithidia fasciculata [Ta 99.92
d1mo9a3140 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.88
d1nhpa3126 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.87
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.55
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.48
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.47
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.46
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.45
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.44
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.39
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.39
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.33
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.33
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.19
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.18
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.12
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.05
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.03
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.01
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.01
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.41
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.34
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.81
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.64
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.42
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.25
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 93.74
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 93.66
d1d7ya397 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.24
d1q1ra3103 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.13
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 89.49
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 86.91
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 85.7
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 81.68
>d1h6va3 d.87.1.1 (A:367-499) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: CO dehydrogenase flavoprotein C-domain-like
superfamily: FAD/NAD-linked reductases, dimerisation (C-terminal) domain
family: FAD/NAD-linked reductases, dimerisation (C-terminal) domain
domain: Mammalian thioredoxin reductase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.96  E-value=1.5e-29  Score=190.77  Aligned_cols=133  Identities=56%  Similarity=1.068  Sum_probs=114.3

Q ss_pred             cccceeEEEcCCceeeecCCHHHHHHhhCCCCEEEEEEeeccccccccCCCCCceEEEEEEecCCCCeEEEEEEECccHH
Q psy11186         80 YQNVATTVFTPLEYGCVGLSEEKAEELYGADNLEIYHAYYKPTEFFIPQRNPQRCYLKVVCERAAPQKVLGMHFIGPNAG  159 (212)
Q Consensus        80 ~~~~~~~~~~~~~ia~vGlt~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~klv~d~~~~g~ilGa~~vg~~a~  159 (212)
                      |..+|+++|++|++|+||+||+||+++++++++.++...+.+..+.....+...++.+++++.+++++|||+|++|++|+
T Consensus         1 Y~~VP~~vfT~PeiA~VGlte~eA~~~g~~~~v~v~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~ILGa~ivg~~A~   80 (133)
T d1h6va3           1 YDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNNKCYAKVICNLKDNERVVGFHVLGPNAG   80 (133)
T ss_dssp             CSSCCEEECSSSCEEEEECCHHHHHHHHCGGGEEEEEEEECCHHHHTTTCCTTCEEEEEEEEGGGTTEEEEEEEESTTHH
T ss_pred             CCCCCEEecCcchheeEeCCHHHHHHhccccccchheeccchhhhhhhhhcccccceEEEEEecCcccEEEEEEeCCCHH
Confidence            56799999999999999999999999988777877776776655544433334555555554267899999999999999


Q ss_pred             HHHHHHHHHHHCCCCHHHHhhcccCCCCchhhHHHHHhhhhcCCCCCCCCCCC
Q psy11186        160 EVIQGYAAAVKCGLTFETLESTVGIHPTLAEEFTRVTITKRSGEDPTPQSCCS  212 (212)
Q Consensus       160 ~~i~~~~~ai~~~~t~~~l~~~~~~~P~~~e~~~~~~~~~~~~~~~~~~~~~~  212 (212)
                      |+|+.++++|++++|+++|.+.+++|||++|.|..+..++|...|++++|||.
T Consensus        81 ElI~~~~~ai~~~~t~~~l~~~i~~hPT~sE~~~~l~~~~~s~~~~~~~~cc~  133 (133)
T d1h6va3          81 EVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTKRSGGDILQSGCCG  133 (133)
T ss_dssp             HHHHHHHHHHHTTCBHHHHHHSCCCTTCGGGGGGGCCCBGGGCCCCCCCSCCC
T ss_pred             HHHHHHHHHHHcCCCHHHHhhccccCCCHHHHHHHhhhhhhccCCccccCCCC
Confidence            99999999999999999999999999999999988888899999999999994
>d1v59a3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dxla3 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xdia2 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1onfa3 d.87.1.1 (A:377-495) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1feca3 d.87.1.1 (A:358-485) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1mo9a3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1nhpa3 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1d7ya3 d.87.1.1 (A:309-405) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1q1ra3 d.87.1.1 (A:320-422) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure