Diaphorina citri psyllid: psy11191


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MTSSKGQAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEAHNGGFFEYTGKAIKW
ccHHHHHHHHHHHHHHHHHHHccccEEEEEEcccCECcccccccccccHHHHHHHHHHHHHHcccccccEEEccccccccc
MTSSKGQAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEAHNGGFFEYTGKAIKW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSSKGQAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEAHNGGFFEYTGKAIKW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004090 [MF]carbonyl reductase (NADPH) activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SNY, chain A
Confidence level:very confident
Coverage over the Query: 2-81
View the alignment between query and template
View the model in PyMOL