Psyllid ID: psy11191


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MTSSKGQAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEAHNGGFFEYTGKAIKW
ccHHHHHHHHHHHHHHHHHHHccccEEEEEEcccEEEcccccccccccHHHHHHHHHHHHHHcccccccEEEccccccccc
ccHHHHHHHHHHHHHHHHHHcHHHccEEEEEEcccEccccccccccccHHHHHHHHHHHHHHcccccccEEEEcccccccc
MTSSKGQAALNAATRSLSIDLKGDKIIAtamhpgwvktdmggsnaplevgAATAGIIQFIQSLgeahnggffeytgkaikw
mtsskgqaALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEAHNGGFFEYTGKAIKW
MTSSKGQAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEAHNGGFFEYTGKAIKW
****************LSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEAHNGGFFEYTGK****
MTSSKGQAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEAHNGGFFEYTGKAIKW
***********AATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEAHNGGFFEYTGKAIKW
MTSSKGQAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEAHNGGFFEYTGKAIKW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooo
iiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSSKGQAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEAHNGGFFEYTGKAIKW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query81 2.2.26 [Sep-21-2011]
P21158166 C-factor OS=Myxococcus xa no N/A 0.925 0.451 0.426 2e-14
Q28960289 Carbonyl reductase [NADPH yes N/A 0.814 0.228 0.420 9e-06
P36086256 Uncharacterized oxidoredu yes N/A 0.876 0.277 0.367 7e-05
Q3SZD7277 Carbonyl reductase [NADPH no N/A 0.802 0.234 0.4 0.0002
P47844277 Carbonyl reductase [NADPH no N/A 0.703 0.205 0.440 0.0004
>sp|P21158|CSGA_MYXXA C-factor OS=Myxococcus xanthus GN=csgA PE=1 SV=1 Back     alignment and function desciption
 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 47/75 (62%)

Query: 7   QAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEA 66
           +AALN A RS+S DL+ +  +   +HPGWV+TDMGG +A L    +  G+++ I  L   
Sbjct: 92  KAALNMAVRSMSTDLRPEGFVTVLLHPGWVQTDMGGPDATLPAPDSVRGMLRVIDGLNPE 151

Query: 67  HNGGFFEYTGKAIKW 81
           H+G FF+Y G  + W
Sbjct: 152 HSGRFFDYQGTEVPW 166




Cell-cell signaling protein required for fruiting body morphogenesis. Necessary for cellular aggregation, for spore differentiation, and for gene expression that is initiated after 6 hour of starvation.
Myxococcus xanthus (taxid: 34)
>sp|Q28960|CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3 Back     alignment and function description
>sp|P36086|YKH1_YEAST Uncharacterized oxidoreductase YKL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL071W PE=1 SV=1 Back     alignment and function description
>sp|Q3SZD7|CBR1_BOVIN Carbonyl reductase [NADPH] 1 OS=Bos taurus GN=CBR1 PE=2 SV=1 Back     alignment and function description
>sp|P47844|CBR1_RABIT Carbonyl reductase [NADPH] 1 OS=Oryctolagus cuniculus GN=CBR1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
270004396 1373 hypothetical protein TcasGA2_TC003732 [T 0.925 0.054 0.586 2e-22
189235593 370 PREDICTED: similar to short-chain dehydr 0.925 0.202 0.586 2e-22
195448977 247 GK10240 [Drosophila willistoni] gi|19416 0.925 0.303 0.56 3e-20
157132840 247 short-chain dehydrogenase [Aedes aegypti 0.925 0.303 0.56 4e-20
157139230128 1-hydroxy-2-glutathionyl-2-methyl-3-bute 0.925 0.585 0.56 5e-20
195043384 247 GH11969 [Drosophila grimshawi] gi|193901 0.925 0.303 0.573 5e-20
289741513 247 putative short chain-type dehydrogenase 0.925 0.303 0.56 2e-19
195396541 247 GJ16775 [Drosophila virilis] gi|19414665 0.925 0.303 0.546 3e-19
170039978 247 short-chain dehydrogenase [Culex quinque 0.925 0.303 0.56 4e-19
307208681 248 C-factor [Harpegnathos saltator] 0.925 0.302 0.546 4e-19
>gi|270004396|gb|EFA00844.1| hypothetical protein TcasGA2_TC003732 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/75 (58%), Positives = 62/75 (82%)

Query: 7    QAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEA 66
            +AALN AT+SLS+DL+ D I+ T +HPGWVKTDMGGSNAPL+V  +  GI++ I+++ E+
Sbjct: 1299 KAALNMATKSLSVDLQKDGILVTGIHPGWVKTDMGGSNAPLDVDTSVVGILELIRNVNES 1358

Query: 67   HNGGFFEYTGKAIKW 81
            HNGGF++Y GK ++W
Sbjct: 1359 HNGGFYQYDGKQLEW 1373




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189235593|ref|XP_968272.2| PREDICTED: similar to short-chain dehydrogenase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195448977|ref|XP_002071895.1| GK10240 [Drosophila willistoni] gi|194167980|gb|EDW82881.1| GK10240 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|157132840|ref|XP_001662664.1| short-chain dehydrogenase [Aedes aegypti] gi|108881627|gb|EAT45852.1| AAEL002901-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157139230|ref|XP_001647567.1| 1-hydroxy-2-glutathionyl-2-methyl-3-butene dehydrogenase, putative [Aedes aegypti] gi|108865682|gb|EAT32235.1| AAEL015653-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195043384|ref|XP_001991609.1| GH11969 [Drosophila grimshawi] gi|193901367|gb|EDW00234.1| GH11969 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|289741513|gb|ADD19504.1| putative short chain-type dehydrogenase [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|195396541|ref|XP_002056890.1| GJ16775 [Drosophila virilis] gi|194146657|gb|EDW62376.1| GJ16775 [Drosophila virilis] Back     alignment and taxonomy information
>gi|170039978|ref|XP_001847792.1| short-chain dehydrogenase [Culex quinquefasciatus] gi|167863572|gb|EDS26955.1| short-chain dehydrogenase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|307208681|gb|EFN85971.1| C-factor [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
FB|FBgn0030026247 sni "sniffer" [Drosophila mela 0.925 0.303 0.56 1.9e-19
ZFIN|ZDB-GENE-050417-323255 zgc:110339 "zgc:110339" [Danio 0.925 0.294 0.466 4.7e-16
UNIPROTKB|E1BUD0253 LOC771069 "Uncharacterized pro 0.925 0.296 0.466 9.8e-16
ZFIN|ZDB-GENE-050419-83256 si:dkey-12e7.4 "si:dkey-12e7.4 0.925 0.292 0.44 6.9e-15
ZFIN|ZDB-GENE-040912-22258 zgc:92161 "zgc:92161" [Danio r 0.925 0.290 0.426 6.2e-14
ZFIN|ZDB-GENE-050417-237256 zgc:112146 "zgc:112146" [Danio 0.962 0.304 0.435 6.2e-14
ZFIN|ZDB-GENE-051113-92256 zgc:123284 "zgc:123284" [Danio 0.962 0.304 0.423 2.1e-13
TIGR_CMR|CBU_0962232 CBU_0962 "oxidoreductase, shor 0.925 0.323 0.453 2.7e-13
ZFIN|ZDB-GENE-070424-53257 zgc:163083 "zgc:163083" [Danio 0.925 0.291 0.413 2.7e-13
ZFIN|ZDB-GENE-070112-892278 zgc:158868 "zgc:158868" [Danio 0.925 0.269 0.426 7.7e-13
FB|FBgn0030026 sni "sniffer" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 232 (86.7 bits), Expect = 1.9e-19, P = 1.9e-19
 Identities = 42/75 (56%), Positives = 55/75 (73%)

Query:     7 QAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEA 66
             ++ALNAAT+SLS+DL   +I+  ++HPGWVKTDMGGS+APL+V  +T  I+Q I  LGE 
Sbjct:   173 KSALNAATKSLSVDLYPQRIMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGEK 232

Query:    67 HNGGFFEYTGKAIKW 81
              NGGF  Y G  + W
Sbjct:   233 QNGGFVNYDGTPLAW 247




GO:0008152 "metabolic process" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004090 "carbonyl reductase (NADPH) activity" evidence=IDA
ZFIN|ZDB-GENE-050417-323 zgc:110339 "zgc:110339" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BUD0 LOC771069 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050419-83 si:dkey-12e7.4 "si:dkey-12e7.4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-22 zgc:92161 "zgc:92161" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-237 zgc:112146 "zgc:112146" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051113-92 zgc:123284 "zgc:123284" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0962 CBU_0962 "oxidoreductase, short chain dehydrogenase/reductase family" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070424-53 zgc:163083 "zgc:163083" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070112-892 zgc:158868 "zgc:158868" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 5e-24
PRK06953222 PRK06953, PRK06953, short chain dehydrogenase; Pro 6e-18
PRK08177225 PRK08177, PRK08177, short chain dehydrogenase; Pro 3e-16
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 3e-14
cd08951260 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 1e-04
COG1028251 COG1028, FabG, Dehydrogenases with different speci 1e-04
cd05233234 cd05233, SDR_c, classical (c) SDRs 2e-04
cd05350239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 0.002
cd05327269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 0.002
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 0.003
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 0.003
PRK08251248 PRK08251, PRK08251, short chain dehydrogenase; Pro 0.003
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
 Score = 90.0 bits (224), Expect = 5e-24
 Identities = 36/82 (43%), Positives = 51/82 (62%), Gaps = 6/82 (7%)

Query: 4   SKGQAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNA----PLEVGAATAGIIQF 59
           SK  AALN  T+SL+++LK D I   ++HPGWV+TDMGG  A    P+    + AG+++ 
Sbjct: 154 SK--AALNMLTKSLAVELKRDGITVVSLHPGWVRTDMGGPFAKNKGPITPEESVAGLLKV 211

Query: 60  IQSLGEAHNGGFFEYTGKAIKW 81
           I +L E  +G F +Y G  I W
Sbjct: 212 IDNLNEEDSGKFLDYDGTEIPW 233


Sniffer is an NADPH-dependent carbonyl reductase of the classical SDR family. Studies in Drosophila melanogaster implicate Sniffer in the prevention of neurodegeneration due to aging and oxidative-stress. This subgroup also includes Rhodococcus sp. AD45 IsoH, which is an NAD-dependent 1-hydroxy-2-glutathionyl-2-methyl-3-butene dehydrogenase involved in isoprene metabolism, Aspergillus nidulans StcE encoded by a gene which is part of a proposed sterigmatocystin biosynthesis gene cluster, Bacillus circulans SANK 72073 BtrF encoded by a gene found in the butirosin biosynthesis gene cluster, and Aspergillus parasiticus nor-1 involved in the biosynthesis of aflatoxins. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. Length = 233

>gnl|CDD|180774 PRK06953, PRK06953, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236173 PRK08177, PRK08177, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187654 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 ketoreductase (KR), classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|181324 PRK08251, PRK08251, short chain dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 81
KOG1611|consensus249 99.87
KOG1200|consensus256 99.73
PRK09009235 C factor cell-cell signaling protein; Provisional 99.72
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.72
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.72
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.71
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.71
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.71
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.7
PRK08177225 short chain dehydrogenase; Provisional 99.7
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.69
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.69
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.69
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.69
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.69
PRK05884223 short chain dehydrogenase; Provisional 99.69
PRK06114254 short chain dehydrogenase; Provisional 99.68
PRK06940275 short chain dehydrogenase; Provisional 99.68
PRK05867253 short chain dehydrogenase; Provisional 99.68
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.68
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.67
PRK08589272 short chain dehydrogenase; Validated 99.67
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.66
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.66
PRK08339263 short chain dehydrogenase; Provisional 99.66
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 99.66
PRK08340259 glucose-1-dehydrogenase; Provisional 99.64
PRK07791286 short chain dehydrogenase; Provisional 99.63
PRK12747252 short chain dehydrogenase; Provisional 99.63
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.63
PRK07063260 short chain dehydrogenase; Provisional 99.62
PRK07478254 short chain dehydrogenase; Provisional 99.62
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.62
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.61
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.61
PRK07831262 short chain dehydrogenase; Provisional 99.61
PRK07035252 short chain dehydrogenase; Provisional 99.6
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.6
PRK08303305 short chain dehydrogenase; Provisional 99.59
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.59
PRK06172253 short chain dehydrogenase; Provisional 99.58
PLN00015308 protochlorophyllide reductase 99.58
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.58
PRK12742237 oxidoreductase; Provisional 99.58
PRK06484520 short chain dehydrogenase; Validated 99.58
PRK05599246 hypothetical protein; Provisional 99.58
PRK06125259 short chain dehydrogenase; Provisional 99.57
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.57
PRK07985294 oxidoreductase; Provisional 99.57
PRK07062265 short chain dehydrogenase; Provisional 99.57
PRK08277278 D-mannonate oxidoreductase; Provisional 99.56
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.56
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.56
KOG0725|consensus270 99.56
PRK08265261 short chain dehydrogenase; Provisional 99.55
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.55
PRK06947248 glucose-1-dehydrogenase; Provisional 99.54
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.54
PRK08936261 glucose-1-dehydrogenase; Provisional 99.54
PRK06841255 short chain dehydrogenase; Provisional 99.54
PRK08643256 acetoin reductase; Validated 99.53
PRK06128300 oxidoreductase; Provisional 99.53
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.53
PRK06523260 short chain dehydrogenase; Provisional 99.53
PRK06953222 short chain dehydrogenase; Provisional 99.53
KOG1207|consensus245 99.52
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.52
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.51
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.51
PRK06398258 aldose dehydrogenase; Validated 99.51
PRK12743256 oxidoreductase; Provisional 99.5
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.48
PRK07856252 short chain dehydrogenase; Provisional 99.48
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.48
PRK06949258 short chain dehydrogenase; Provisional 99.48
PRK07578199 short chain dehydrogenase; Provisional 99.47
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.47
PLN02253280 xanthoxin dehydrogenase 99.47
COG0300265 DltE Short-chain dehydrogenases of various substra 99.47
PLN02780320 ketoreductase/ oxidoreductase 99.47
PRK08226263 short chain dehydrogenase; Provisional 99.46
PRK08278273 short chain dehydrogenase; Provisional 99.46
PRK12744257 short chain dehydrogenase; Provisional 99.46
PRK07577234 short chain dehydrogenase; Provisional 99.46
PRK08628258 short chain dehydrogenase; Provisional 99.46
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.45
PRK06483236 dihydromonapterin reductase; Provisional 99.44
PRK07067257 sorbitol dehydrogenase; Provisional 99.44
PRK08703239 short chain dehydrogenase; Provisional 99.44
PRK06701290 short chain dehydrogenase; Provisional 99.44
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.44
PRK09242257 tropinone reductase; Provisional 99.43
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.43
PRK06484 520 short chain dehydrogenase; Validated 99.43
PRK07677252 short chain dehydrogenase; Provisional 99.42
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.42
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.41
PRK06198260 short chain dehydrogenase; Provisional 99.41
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.41
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.4
PRK12939250 short chain dehydrogenase; Provisional 99.4
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.4
PRK09186256 flagellin modification protein A; Provisional 99.4
PRK06123248 short chain dehydrogenase; Provisional 99.4
PRK12937245 short chain dehydrogenase; Provisional 99.39
PRK06196315 oxidoreductase; Provisional 99.39
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.38
PRK07904253 short chain dehydrogenase; Provisional 99.38
PRK05872296 short chain dehydrogenase; Provisional 99.37
PRK06057255 short chain dehydrogenase; Provisional 99.37
PRK06139330 short chain dehydrogenase; Provisional 99.37
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.36
PRK05866293 short chain dehydrogenase; Provisional 99.35
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.35
KOG4169|consensus261 99.35
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.35
PRK05855582 short chain dehydrogenase; Validated 99.34
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.34
PRK07060245 short chain dehydrogenase; Provisional 99.34
PRK06500249 short chain dehydrogenase; Provisional 99.34
PRK06924251 short chain dehydrogenase; Provisional 99.34
PRK07069251 short chain dehydrogenase; Validated 99.33
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.33
PRK08862227 short chain dehydrogenase; Provisional 99.32
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.32
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.32
PRK12827249 short chain dehydrogenase; Provisional 99.32
PRK06138252 short chain dehydrogenase; Provisional 99.31
PRK05993277 short chain dehydrogenase; Provisional 99.31
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.3
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.3
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.3
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.3
PRK07074257 short chain dehydrogenase; Provisional 99.3
PRK07576264 short chain dehydrogenase; Provisional 99.29
PRK06101240 short chain dehydrogenase; Provisional 99.29
PRK05717255 oxidoreductase; Validated 99.28
PRK07774250 short chain dehydrogenase; Provisional 99.28
PRK07825273 short chain dehydrogenase; Provisional 99.28
PRK05875276 short chain dehydrogenase; Provisional 99.28
PRK07814263 short chain dehydrogenase; Provisional 99.28
PRK07102243 short chain dehydrogenase; Provisional 99.27
PRK07890258 short chain dehydrogenase; Provisional 99.26
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.26
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.25
PRK09134258 short chain dehydrogenase; Provisional 99.24
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.24
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.24
PRK07832272 short chain dehydrogenase; Provisional 99.23
PRK12746254 short chain dehydrogenase; Provisional 99.23
PRK06197306 short chain dehydrogenase; Provisional 99.22
PRK07024257 short chain dehydrogenase; Provisional 99.22
PRK05876275 short chain dehydrogenase; Provisional 99.21
PRK06182273 short chain dehydrogenase; Validated 99.21
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.21
PRK07454241 short chain dehydrogenase; Provisional 99.2
PRK09072263 short chain dehydrogenase; Provisional 99.2
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.2
PRK05693274 short chain dehydrogenase; Provisional 99.2
PRK07201657 short chain dehydrogenase; Provisional 99.2
PRK07806248 short chain dehydrogenase; Provisional 99.2
PRK05650270 short chain dehydrogenase; Provisional 99.19
COG0623259 FabI Enoyl-[acyl-carrier-protein] 99.18
PRK08251248 short chain dehydrogenase; Provisional 99.18
KOG1201|consensus300 99.18
KOG1610|consensus322 99.17
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.17
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.16
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.16
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.15
COG1028251 FabG Dehydrogenases with different specificities ( 99.15
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.15
PRK07041230 short chain dehydrogenase; Provisional 99.13
PRK07109334 short chain dehydrogenase; Provisional 99.13
PRK05854313 short chain dehydrogenase; Provisional 99.11
KOG1204|consensus253 99.11
PRK12828239 short chain dehydrogenase; Provisional 99.1
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.1
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.09
PRK12367245 short chain dehydrogenase; Provisional 99.08
PRK08267260 short chain dehydrogenase; Provisional 99.08
PRK06179270 short chain dehydrogenase; Provisional 99.08
PRK10538248 malonic semialdehyde reductase; Provisional 99.08
PRK08263275 short chain dehydrogenase; Provisional 99.08
PRK08324681 short chain dehydrogenase; Validated 99.07
KOG1205|consensus282 99.07
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.07
PRK06180277 short chain dehydrogenase; Provisional 99.04
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.03
PRK06181263 short chain dehydrogenase; Provisional 99.02
PRK12829264 short chain dehydrogenase; Provisional 99.02
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.01
PRK07326237 short chain dehydrogenase; Provisional 99.0
KOG1199|consensus260 98.99
PRK07023243 short chain dehydrogenase; Provisional 98.97
PRK06914280 short chain dehydrogenase; Provisional 98.97
KOG1209|consensus289 98.97
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 98.97
PRK09135249 pteridine reductase; Provisional 98.94
PRK08264238 short chain dehydrogenase; Validated 98.94
PRK07775274 short chain dehydrogenase; Provisional 98.92
KOG1208|consensus314 98.88
PRK06194287 hypothetical protein; Provisional 98.8
PRK08017256 oxidoreductase; Provisional 98.79
PRK06482276 short chain dehydrogenase; Provisional 98.79
KOG1210|consensus331 98.67
PRK09291257 short chain dehydrogenase; Provisional 98.63
KOG1014|consensus312 98.6
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 98.58
PRK07424406 bifunctional sterol desaturase/short chain dehydro 98.48
PRK08219227 short chain dehydrogenase; Provisional 98.47
KOG4022|consensus236 98.38
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.29
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 97.55
PLN03209 576 translocon at the inner envelope of chloroplast su 97.31
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 97.29
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 97.02
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 96.03
TIGR01746367 Thioester-redct thioester reductase domain. It has 95.89
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 95.85
KOG1478|consensus341 95.76
smart00822180 PKS_KR This enzymatic domain is part of bacterial 95.75
PLN02583297 cinnamoyl-CoA reductase 95.72
PLN02686367 cinnamoyl-CoA reductase 94.94
PF08643299 DUF1776: Fungal family of unknown function (DUF177 94.19
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 93.75
PLN02650351 dihydroflavonol-4-reductase 93.38
KOG1502|consensus327 91.99
COG1088 340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 91.73
PLN00198338 anthocyanidin reductase; Provisional 89.11
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 88.37
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 87.77
PLN02653340 GDP-mannose 4,6-dehydratase 87.13
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 86.49
PLN02214342 cinnamoyl-CoA reductase 86.32
PLN02896 353 cinnamyl-alcohol dehydrogenase 86.18
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 85.49
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 85.43
KOG0747|consensus331 84.81
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 81.44
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 80.56
>KOG1611|consensus Back     alignment and domain information
Probab=99.87  E-value=1e-21  Score=112.94  Aligned_cols=81  Identities=44%  Similarity=0.777  Sum_probs=78.3

Q ss_pred             CcchhhHHHHHHHHHHHHhhhcCCceEEEEecCCceecCCCCCCCCCCHHHHHHHHHHHHhhhCccccceeeccCCeeec
Q psy11191          1 MTSSKGQAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEAHNGGFFEYTGKAIK   80 (81)
Q Consensus         1 ~~Y~~sK~a~~~~~~~l~~e~~~~~i~v~~v~PG~~~T~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~G~~~~~~~~~~~   80 (81)
                      .+|.+||+|++.|+|+++.|+++.+|.|..+|||||+|+|......+++|+.+..++..+.....+.+|.||++|+..+|
T Consensus       169 ~AYrmSKaAlN~f~ksls~dL~~~~ilv~sihPGwV~TDMgg~~a~ltveeSts~l~~~i~kL~~~hnG~ffn~dlt~ip  248 (249)
T KOG1611|consen  169 SAYRMSKAALNMFAKSLSVDLKDDHILVVSIHPGWVQTDMGGKKAALTVEESTSKLLASINKLKNEHNGGFFNRDGTPIP  248 (249)
T ss_pred             hhhHhhHHHHHHHHHHhhhhhcCCcEEEEEecCCeEEcCCCCCCcccchhhhHHHHHHHHHhcCcccCcceEccCCCcCC
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             C
Q psy11191         81 W   81 (81)
Q Consensus        81 ~   81 (81)
                      |
T Consensus       249 f  249 (249)
T KOG1611|consen  249 F  249 (249)
T ss_pred             C
Confidence            8



>KOG1200|consensus Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4022|consensus Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>KOG0747|consensus Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
1sny_A267 Carbonyl Reductase Sniffer Of D. Melanogaster Lengt 5e-19
1yo6_A250 Crystal Structure Of The Putative Carbonyl Reductas 6e-11
1n5d_A288 Crystal Structure Of Porcine Testicular Carbonyl Re 7e-07
1wma_A276 Crystal Structure Of Human Cbr1 In Complex With Hyd 1e-04
2pfg_A276 Crystal Structure Of Human Cbr1 In Complex With Big 1e-04
>pdb|1SNY|A Chain A, Carbonyl Reductase Sniffer Of D. Melanogaster Length = 267 Back     alignment and structure

Iteration: 1

Score = 89.4 bits (220), Expect = 5e-19, Method: Composition-based stats. Identities = 41/75 (54%), Positives = 53/75 (70%) Query: 7 QAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEA 66 ++ALNAAT+SLS+DL +I ++HPGWVKTD GGS+APL+V +T I+Q I LGE Sbjct: 193 KSALNAATKSLSVDLYPQRIXCVSLHPGWVKTDXGGSSAPLDVPTSTGQIVQTISKLGEK 252 Query: 67 HNGGFFEYTGKAIKW 81 NGGF Y G + W Sbjct: 253 QNGGFVNYDGTPLAW 267
>pdb|1YO6|A Chain A, Crystal Structure Of The Putative Carbonyl Reductase Sniffer Of Caenorhabditis Elegans Length = 250 Back     alignment and structure
>pdb|1N5D|A Chain A, Crystal Structure Of Porcine Testicular Carbonyl Reductase 20beta-Hydroxysteroid Dehydrogenase Length = 288 Back     alignment and structure
>pdb|1WMA|A Chain A, Crystal Structure Of Human Cbr1 In Complex With Hydroxy-pp Length = 276 Back     alignment and structure
>pdb|2PFG|A Chain A, Crystal Structure Of Human Cbr1 In Complex With Bigf2 Length = 276 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 1e-30
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 1e-30
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 1e-10
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 3e-10
4e4y_A244 Short chain dehydrogenase family protein; structur 6e-04
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 9e-04
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 9e-04
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
 Score =  107 bits (268), Expect = 1e-30
 Identities = 32/79 (40%), Positives = 46/79 (58%), Gaps = 2/79 (2%)

Query: 3   SSKGQAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQS 62
            SK  AA+N   R+L++DLK D ++     PGWV+T++GG NA L V  +TA +I     
Sbjct: 174 MSK--AAINMFGRTLAVDLKDDNVLVVNFCPGWVQTNLGGKNAALTVEQSTAELISSFNK 231

Query: 63  LGEAHNGGFFEYTGKAIKW 81
           L  +HNG FF    K  ++
Sbjct: 232 LDNSHNGRFFMRNLKPYEF 250


>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query81
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.85
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.85
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.84
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.84
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.84
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.83
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.82
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.82
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.79
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.78
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.77
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.75
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.75
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.74
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.74
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.74
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.73
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.73
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.73
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.73
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.73
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.72
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.72
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.72
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.72
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.72
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.72
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.72
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.71
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.71
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.71
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.71
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.7
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.7
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.7
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.7
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.7
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.7
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.7
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.69
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.69
4e4y_A244 Short chain dehydrogenase family protein; structur 99.69
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.69
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.69
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.69
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.69
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.68
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.68
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.68
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.68
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.68
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.68
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.68
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.68
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.68
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.68
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.68
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.68
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.68
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.67
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.67
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.67
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.67
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.67
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.67
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.67
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.67
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.67
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.67
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.67
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.67
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.67
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.67
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.66
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.66
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.66
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.66
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.66
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.66
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.66
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.66
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.66
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.66
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.66
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.66
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.66
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.66
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.65
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.65
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.65
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.65
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.65
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.65
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.65
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.65
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.64
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.64
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.64
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.64
3rih_A293 Short chain dehydrogenase or reductase; structural 99.64
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.64
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.64
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.63
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.63
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.63
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.63
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.63
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.63
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.63
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.63
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.63
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.63
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.62
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.62
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.62
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.62
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.62
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.62
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.61
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.61
3cxt_A291 Dehydrogenase with different specificities; rossma 99.61
1xkq_A280 Short-chain reductase family member (5D234); parra 99.61
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.61
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.61
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.6
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.6
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.6
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.6
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.6
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.6
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.6
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.6
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.6
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.6
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.59
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.59
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.59
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.59
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.59
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.59
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.59
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.59
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.58
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.58
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.58
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.58
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.58
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.58
1spx_A278 Short-chain reductase family member (5L265); paral 99.58
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.57
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.57
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.57
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.57
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.57
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.57
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.57
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.56
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.56
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.56
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.55
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.55
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.55
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.55
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.54
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.54
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.54
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.54
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.54
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.53
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.53
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.53
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.53
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.53
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.53
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.53
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.52
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.52
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.52
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.51
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.51
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.51
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.51
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.5
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.49
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.49
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.48
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.48
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.48
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.48
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.47
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.47
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.46
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.46
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.46
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.45
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 99.44
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.44
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.43
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.43
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.42
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.41
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.41
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.4
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.4
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.39
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.37
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.37
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.34
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.32
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.27
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.27
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.25
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.25
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.24
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.23
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.06
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.97
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 98.96
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 98.95
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 98.58
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 98.31
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 98.27
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 98.03
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 98.02
3slk_A795 Polyketide synthase extender module 2; rossmann fo 98.02
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.95
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 97.95
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.85
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 97.75
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 97.7
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 97.68
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 97.67
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 97.65
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 97.55
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 97.55
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.53
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.34
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 97.32
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.31
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 97.3
1xq6_A253 Unknown protein; structural genomics, protein stru 97.21
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 97.21
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 97.19
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.17
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 97.16
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 97.15
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.08
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 96.92
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.91
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 96.9
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 96.89
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 96.87
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 96.85
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 96.84
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 96.81
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 96.79
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 96.77
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 96.71
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 96.69
4f6c_A427 AUSA reductase domain protein; thioester reductase 96.62
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 96.55
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 96.55
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 96.42
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 96.42
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 96.34
3slg_A372 PBGP3 protein; structural genomics, seattle struct 96.29
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 96.22
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 96.16
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 96.12
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.96
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 95.78
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 95.77
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 95.6
2wm3_A299 NMRA-like family domain containing protein 1; unkn 95.58
3ius_A286 Uncharacterized conserved protein; APC63810, silic 95.44
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 95.43
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 95.38
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 95.26
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 95.2
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 95.16
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 94.86
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 94.78
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 94.68
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 94.5
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 94.27
4f6l_B508 AUSA reductase domain protein; thioester reductase 94.17
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 93.96
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 93.66
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 93.64
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 93.35
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 93.31
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 93.14
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 92.93
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 92.8
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 92.73
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 92.14
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 92.12
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 91.55
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 91.52
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 91.19
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 90.38
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 88.38
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 87.02
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 86.08
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 80.24
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
Probab=99.85  E-value=1.1e-21  Score=114.29  Aligned_cols=77  Identities=21%  Similarity=0.296  Sum_probs=66.8

Q ss_pred             cchhhHHHHHHHHHHHHhhhcCCceEEEEecCCceecCCCCCC-----------------CCCCHHHHHHHHHHHHhhhC
Q psy11191          2 TSSKGQAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSN-----------------APLEVGAATAGIIQFIQSLG   64 (81)
Q Consensus         2 ~Y~~sK~a~~~~~~~l~~e~~~~~i~v~~v~PG~~~T~~~~~~-----------------~~~~~~~~a~~~~~~~~~~~   64 (81)
                      +|++||+|+.+|+|+|+.|++++|||||+|+||+++|+|....                 +..+|+|+|..+++++++..
T Consensus       146 ~Y~asKaav~~ltr~lA~Ela~~gIrVNaV~PG~i~T~m~~~~~~~~~~~~~~~~~~PlgR~g~peeiA~~v~fLaSd~a  225 (242)
T 4b79_A          146 AYSASKGAIVQLTRSLACEYAAERIRVNAIAPGWIDTPLGAGLKADVEATRRIMQRTPLARWGEAPEVASAAAFLCGPGA  225 (242)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEECSBCCC-----CCCHHHHHHHHHTCTTCSCBCHHHHHHHHHHHTSGGG
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhcCeEEEEEEeCCCCChhhhcccCCHHHHHHHHhcCCCCCCcCHHHHHHHHHHHhCchh
Confidence            6999999999999999999999999999999999999986531                 23579999999999999888


Q ss_pred             ccccceeeccCCee
Q psy11191         65 EAHNGGFFEYTGKA   78 (81)
Q Consensus        65 ~~~~G~~~~~~~~~   78 (81)
                      ...+|+.+.+||..
T Consensus       226 ~~iTG~~l~VDGG~  239 (242)
T 4b79_A          226 SFVTGAVLAVDGGY  239 (242)
T ss_dssp             TTCCSCEEEESTTG
T ss_pred             cCccCceEEECccH
Confidence            88999999999863



>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 81
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 4e-17
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 9e-15
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 1e-05
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 5e-05
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 5e-05
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 6e-05
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 7e-05
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 7e-05
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 8e-05
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 1e-04
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 2e-04
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 2e-04
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 2e-04
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 3e-04
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 3e-04
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 4e-04
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 5e-04
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 5e-04
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 5e-04
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 6e-04
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 6e-04
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 0.001
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 0.001
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 0.001
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 0.001
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 0.001
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 0.002
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 0.002
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 0.003
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 0.003
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 0.003
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 0.003
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 0.003
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 0.004
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 0.004
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Putative carbonyl reductase sniffer
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 70.3 bits (171), Expect = 4e-17
 Identities = 30/74 (40%), Positives = 44/74 (59%)

Query: 8   AALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEAH 67
           AA+N   R+L++DLK D ++     PGWV+T++GG NA L V  +TA +I     L  +H
Sbjct: 177 AAINMFGRTLAVDLKDDNVLVVNFCPGWVQTNLGGKNAALTVEQSTAELISSFNKLDNSH 236

Query: 68  NGGFFEYTGKAIKW 81
           NG FF    K  ++
Sbjct: 237 NGRFFMRNLKPYEF 250


>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query81
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.9
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.9
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.85
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.84
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.83
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.82
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.82
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.82
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.82
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.82
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.82
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.82
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.82
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.82
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.82
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.82
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.82
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.81
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.81
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.81
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.81
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.81
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.8
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.8
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.8
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.8
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.8
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.8
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.8
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.8
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.79
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.79
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.79
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.79
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.79
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.79
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.79
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.79
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.78
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.78
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.78
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.78
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.78
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.77
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.77
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.77
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.77
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.76
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.75
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.75
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.74
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.74
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.74
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.73
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.72
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.71
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.7
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.69
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.67
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.66
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.66
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.64
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.58
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.56
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.46
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 98.52
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 94.22
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 89.09
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 85.95
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 85.67
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 83.46
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 82.77
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 80.96
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Carbonyl reductase sniffer
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.90  E-value=2.7e-24  Score=123.97  Aligned_cols=80  Identities=53%  Similarity=0.946  Sum_probs=75.1

Q ss_pred             cchhhHHHHHHHHHHHHhhhcCCceEEEEecCCceecCCCCCCCCCCHHHHHHHHHHHHhhhCccccceeeccCCeeecC
Q psy11191          2 TSSKGQAALNAATRSLSIDLKGDKIIATAMHPGWVKTDMGGSNAPLEVGAATAGIIQFIQSLGEAHNGGFFEYTGKAIKW   81 (81)
Q Consensus         2 ~Y~~sK~a~~~~~~~l~~e~~~~~i~v~~v~PG~~~T~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~G~~~~~~~~~~~~   81 (81)
                      +|++||+|+.+|+++++.|++++||+||+|+||+++|+|.....+.++++.++.+++.+.....+.+|+|+++||+.+||
T Consensus       169 ~Y~aSKaal~~lt~~la~e~~~~gI~vn~v~PG~v~T~m~~~~~~~~~~~~~~~i~~~i~~l~~~~tG~~i~~dG~~ipW  248 (248)
T d1snya_         169 AYRTSKSALNAATKSLSVDLYPQRIMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGEKQNGGFVNYDGTPLAW  248 (248)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHGGGTCEEEEECCCSBCSTTTCTTCSBCHHHHHHHHHHHHHHCCGGGTTCEECTTSCBCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHhCCCCeEEEEcCCCcccCCcccccCCCCchHHHHHHHHHHHhcCccCCCcEEEECCeEcCC
Confidence            69999999999999999999999999999999999999999888888888888888888877777899999999999999



>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure