Diaphorina citri psyllid: psy11195


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340------
MWNSLSVLRINLSIGLACIQQVSTKVTFSPMIYRTFEFIFTNLVPGNTRHFTSVLGVYRAYNSSKLYRDLKLRGAIVRRKELKMLPREHIYSQYQGVWNLSSDQGNLGVFMATNIRVVWYADMNESFNISLPYIQIASIRLRESKFGLALVIESYEQSGGYVLGFRIDPQETMQTVCKELQSYHRIHTTTPEYGVDYVVSDVAILAEEAPVVQEDIAELEEDDNMLDLSNTLTLYSADHMGGGTASANRKLVFSPELGLCVEQPKPGFTMARLWEVIPSSDMNESFNISLPYIQIASIRLRESKFGLALVIESYEQSGGYVLGFRIDPQVRTKKINCRGDVVVKTW
cccccccccEEEEEEEEEEEEEEEEEECccccccEEEEEEEccccccccEEEEHHHHHHHHHHccHHEEEEcEEEEEEccccccccccEEEEEEccEEEcccccccCEEEEEEEEEEEEEEccccccccccccEEEEEEEEEEcccEEEEEEEEEcccccEEEEEEcccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcHHHHHHccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccEEEEcEEEEEcccEEEEEEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHHHcc
MW**LSVLRINLSIGLACIQQVSTKVTFSPMIYRTFEFIFTNLVPGNTRHFTSVLGVYRAYNSSKLYRDLKLRGAIVRRKELKMLPREHIYSQYQGVWNLSSDQGNLGVFMATNIRVVWYADMNESFNISLPYIQIASIRLRESKFGLALVIESYEQSGGYVLGFRIDPQETMQTVCKELQSYHRIHTTTPEYGVDYVVSDVAILAEEAPVVQEDIAELEEDDNMLDLSNTLTLYSADHMGGGTASANRKLVFSPELGLCVEQPKPGFTMARLWEVIPSSDMNESFNISLPYIQIASIRLRESKFGLALVIESYEQSGGYVLGFRIDPQVRTKKINCRGDVVVKTW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWNSLSVLRINLSIGLACIQQVSTKVTFSPMIYRTFEFIFTNLVPGNTRHFTSVLGVYRAYNSSKLYRDLKLRGAIVRRKELKMLPREHIYSQYQGVWNLSSDQGNLGVFMATNIRVVWYADMNESFNISLPYIQIASIRLRESKFGLALVIESYEQSGGYVLGFRIDPQETMQTVCKELQSYHRIHTTTPEYGVDYVVSDxxxxxxxxxxxxxxxxxxxxxDNMLDLSNTLTLYSADHMGGGTASANRKLVFSPELGLCVEQPKPGFTMARLWEVIPSSDMNESFNISLPYIQIASIRLRESKFGLALVIESYEQSGGYVLGFRIDPQVRTKKINCRGDVVVKTW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bardet-Biedl syndrome 5 protein The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane.confidentQ8N3I7
Bardet-Biedl syndrome 5 protein homolog The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane.confidentQ9CZQ9
Bardet-Biedl syndrome 5 protein homolog Required for ciliogenesis.confidentQ7ZWB7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005932 [CC]microtubule basal bodyprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0005622, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0042995, GO:0043226, GO:0044422
GO:0031513 [CC]nonmotile primary ciliumprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0034464 [CC]BBSomeprobableGO:0043234, GO:0005575, GO:0032991
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0032266 [MF]phosphatidylinositol-3-phosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LW3, chain A
Confidence level:probable
Coverage over the Query: 80-183
View the alignment between query and template
View the model in PyMOL