Psyllid ID: psy1119


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390--
MATRDDVSSSSSEVKRDTDVHIGTLLKEAPRKGLVQLKNSFRSLSASPKRLASTALDRVYQRFQMAWETVSLMRGELYTEVPVVFENIKFMRATNVPKEGSVEFIVMVQKGSGNFEIVEGGAAIVTGKVYIPADVKTEMVRIPDQYKIPRTEGEAIELQSRDIYKELRLRGYHYKGLFRSLNVADGAGTQGKIRWHNNWVAFMDNMLQLQILQYDTRGLFVPTSIQKLVINVSDHVNLLSTLDEETPEYPVFVYKEVEVIKSGGVEIRGLKASAIPRKKPLGEPVLEKYKFIQNEGLKVKSPVKISPLVIKVSGVDFHWIPILQKALAAEETSTKQKIILLSQLEPLSGIIGFFNCIRKETGGERTRCFEILDKNAPPFNPEDPFYKVQVEKDLAVNILRNGQWGTYRHSILQPIKRVMTDHAYINALVRGDMSSLTWEQGPVNMKTWKKYSKDNINHDIAQIYYSSINFRDIMLTTAKLAPEVIESRRLYQHCVIGFEYSGRLRDSGKRVMGLTSGRSLANCCETDVEMAWEIPDQWTLEDAATVPCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMDAEIFTTVGTPEKREFIRKTFPFIKEENIGNSRDTSFEQLVMKRTKGRGVDLVLNSLAEEKLQASVRCLAQGGRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEWKMSLQKALQKAIDAGAVQPLVRTIFPEDKVEEAFRYMAAGKHIGKVIIKIRDEEPTKICTPKVKQLLAVPRYYADSNKSYIICGGLGGFGLELADWLVLRGARKLVLTSRSGVKNGYQALRIKIWKSYDVQVLISTDDITTEAGVVNLLTEANKLGPVDGIFNLAVVLKDALFENQTPEDFNASLGPKANATKYFDKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERICEARRAEGLPGLAVEWGAVGEVGLVADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEPIVASMVVAEKKAGSGGATNIVDAVINILGLRDLKTVSLHSTLAELGMDSMMAVEIKQTLEREFEVFLTPQDIRGLTFAKLQDIAVSFENDDKSKPVSTEASGGQVTALSVEDIPDVGIQYLMRTIGDEILANKPVIRLPSLKNNGSTVEEPVGNNNTIFMVPGIEGIATVLEPLAKNINAQVLVFQFDHTNPPDTIPEMADSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLEQLGTKCHLYLVDSAPDYVLTSLRKLPDWNAKLNYFLDLMPEDATHSRTYQRNLAHAAYKRITSILKYTDPKHKAFGGNITLLRPTEQALPTAEDYGLSKVCKKPVKVHFVDGNHFTVLDNIKSAQIIMHEDSTDFKTALFTSDDTGLNGTLS
cccccccccccccccccccccHHHHHcccccHHHHcccccccccccccHHHHHccccccccHHHHHHHHHHHHHccccccccEEEEEEEEEEEEEcccccEEEEEEEEEcccccEEEEEcccEEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccEEEEcccccEEEEEccccHHHHHHHHHHHHHcccccccEEccccEEEEEEcccHHHHHHHHcccccccEEEEEEcccccEEEEEEEEEcccccccccccccccccEEEEEEccccccccccccccccEEEcccccccccHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHccccccEEEEEEccccccccccccHHHHHHHHcccEEEEEEccEEEcccccccccccccccccEEEEccccccccccEEEEccccccccccccccccccEEEEEEEEcccHHHHHHHHccccHHHHHHccccccccccccEEEEEccccccccEEccccccccEEEEccccEEEccccccHHHHHHcHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHcccccccccccccccHHHHHHHHHcccccEEEEEccccHHHHHHHHcccccccEEEEEEcccccccccccccccccccEEEEEccHHHccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHcccccHHHHHHHcccccccHHHHHHHHHHHHcccccccccHHHHHHHHccccccHHHHHHHHHccccccccccccccHHccccHHHHHHHHHHHHHHHHcccccHHHHccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEcccccHHHcHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHcccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccccccccEEEEccccccccccccccccccccccEEEEEEcccccccccccHHHHHHcccccccHHHHcccccccccccccc
ccHHHHHHHHHHcccEEcccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEcEEcccccEEEEEEEEEcccccEEEEccccccccEEEEEcccccHcccccccccccccccccccEccHHHHHHHHHHccccccHHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHcccccccEEcEEEEEEEEcHHHHHHHEEccccccEEEEEEEcccccEEEEEEEEEEccccHHcccccccccccEEEEEEccccccccccccccccEEEEccHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHcccccEEEEEEccccccccccccHHHHHHHHHccccHEEEEcccEEccEEccccccccccccccEEcEccccccHccccccccccccccccccccccccEEEEEEEEcccHHHHHHHHcccccccccccccccccEEEEEEccEEcccccccccccccccccEEEEEcccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHcccccHHHccccccccHHHHHHHHHcccccEEEEcHHHHHHHHHHHEEcccccEEEEEcccccccccHHHHHHHccccEEEEEEHHHHHHccHHHHHHHHHHHHHHHHcccccccccEEEcHHHHHHHHHHHHHcccccEEEEEEccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHccccccccEEEEHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEHccccccccHHHHHHHHHHHHHHHHHHHHccccHHHEEEccHHHcccEEccccccHHHHccccccccHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHHHHHHHHccccHHHccccHHHHHHcccHHHHHHHHHHHHHHcccEccHHHHccccHHHHHHHHHHHcccccccccccccccccHHHccccccccHHHHHHHHHHcccccccccccccccHccHcccccccccccccEEEEccccHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHcccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEcccccccccccccccEcccccEEEEEEEcccHHHcccccHHHHHHccccHHHHHHHHcccccccccccc
matrddvsssssevkrdtdvHIGTLLKEAPRKGLVQLKNSFrslsaspkRLASTALDRVYQRFQMAWETVSLMRGELYTEVPVVFENIkfmratnvpkegSVEFIVMVQKGsgnfeiveggaaivtgkvyipadvktemvripdqykiprtegeaiELQSRDIYKELRLrgyhykglfrslnvadgagtqgkirwHNNWVAFMDNMLQLQILQydtrglfvptSIQKLVINVSDHVNLlstldeetpeypvfVYKEVEVIKSGGveirglkasaiprkkplgepvlEKYKFIQneglkvkspvkisplvikvsgvdfhwiPILQKALAAEETSTKQKIILLSqleplsgiigffncirketggertrcfeildknappfnpedpfykvQVEKDLAVNILrngqwgtyrhsILQPIKRVMTDHAYINALVRgdmssltweqgpvnmktWKKYSKDNINHDIAQIYYSSINFRDIMLTTAKLAPEVIESRRLYQHCVIgfeysgrlrdsgkrvmgltsgrslanccetDVEMaweipdqwtledaatvpcVYATAVYAMFICGQMQKGESIlihagsggvGQAAINLARYMDAeifttvgtpekrEFIRKtfpfikeenignsrdtSFEQLVMKRTKGRGVDLVLNSLAEEKLQASVRCLAQGgrfleigkfdlannnmlGMEVFMRetsfhgvmldnffFAEQEWKMSLQKALQKAIDagavqplvrtifpeDKVEEAFRYMAAGKHIGKVIIKIrdeeptkictpkvkqllavpryyadsnksyiicgglggFGLELADWLVLRGARKLVLTSRSGVKNGYQALRIKIWKSYDVQVListddittEAGVVNLLTEanklgpvdgIFNLAVVLKDalfenqtpedfnaslgpkanatkyfdkysrtmcptlgqFVVFssvscgrgnagqtnyGMANSIMERICEARraeglpglavewgaVGEVGLVADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEPIVASMVVAEkkagsggatnIVDAVINILGLRDLKTVSLHSTLAELGMDSMMAVEIKQTLEREFevfltpqdirglTFAKLQDIAVSfenddkskpvsteasggqvtalsvedipdVGIQYLMRTIGdeilankpvirlpslknngstveepvgnnntifmvPGIEGIATVLEPLAKNINAQVLVFQfdhtnppdtipeMADSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLEQLGTKCHLylvdsapdyVLTSLRKLPDWNAKLNYFLdlmpedathsrTYQRNLAHAAYKRITSILkytdpkhkafggnitllrpteqalptaedyglskvckkpvkvhfvdgnhftvldniksaqiimhedstDFKTAlftsddtglngtls
matrddvsssssevkrdtdvhigtllkeaprkglvqLKNSfrslsaspkrlASTALDRVYQRFQMAWETVSLMRGELYTEVPVVFENIKFmratnvpkegSVEFIVMVQKGSGNFEIVEGGAAIVTGKvyipadvktemvripdqykiprtegeaielqsrDIYKELRLRGYHYKGLFRSLNVADGAGTQGKIRWHNNWVAFMDNMLQLQILQYDTRGLFVPTSIQKLVINVSDHVNLLSTldeetpeypvFVYKEVEVIKSGgveirglkasaiprkkplgepVLEKYKFIqneglkvkspvkiSPLVIKVSGVDFHWIPILQKALAAEETSTKQKIILLsqleplsgiIGFFNCIRKETGGERTRCFEILdknappfnpEDPFYKVQVEKDLAVNILrngqwgtyRHSILQPIKRVMTDHAYINALVrgdmssltwEQGPVNMKTWKKYSKDNINHDIAQIYYSSINFRDIMLTTAKLAPEVIESRRLYQHCVIGfeysgrlrdsgKRVMGLTSGRSLANCCETDVEMAWEIPDQWTLEDAATVPCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMDAEIfttvgtpekreFIRKTfpfikeenignsrdtsfEQLVMKRTKGRGVDLVLNSLAEEKLQASVRCLAQGGRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEWKMSLQKALQKAIDagavqplvRTIFPEDKVEEAFRYMAAGKHIGKVIIKIrdeeptkictpkvkqllaVPRYYADSNKSYIICGGLGGFGLELADWLVLRGARKlvltsrsgvkngyQALRIKIWKSYDVQVLISTDDITTEAGVVNLLTEANKLGPVDGIFNLAVVLKDALFENQTpedfnaslgpkaNATKYFDKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERICEARRAEGLPGLAVEWGAVGEVGLVADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEPIVASMVVAEKKagsggatnIVDAVINILGLRDLKTVSLHSTLAELGMDSMMAVEIKQTLEREFEVFLTPQDIRGLTFAKLQDIAVSFenddkskpvsteasggqvtalsvedipDVGIQYLMRTIGDEILANKPVIrlpslknngstveepvgnNNTIFMVPGIEGIATVLEPLAKNINAQVLVFQFDHTNPPDTIPEMADSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLEQLGTKCHLYLVDSAPDYVLTSLRKLPDWNAKLNYFLDLMPEDATHSRTYQRNLAHAAYKRITSILKYTDPKHKAFGGNITLLRPTEQALPTAEDYGLSKVCKKPVKVHFVDGNHFTVLDNIKSAQIIMHEDSTDFKTalftsddtglngtls
MATRDDVSSSSSEVKRDTDVHIGTLLKEAPRKGLVQLKNSFRSLSASPKRLASTALDRVYQRFQMAWETVSLMRGELYTEVPVVFENIKFMRATNVPKEGSVEFIVMVQKGSGNFEIVEGGAAIVTGKVYIPADVKTEMVRIPDQYKIPRTEGEAIELQSRDIYKELRLRGYHYKGLFRSLNVADGAGTQGKIRWHNNWVAFMDNMLQLQILQYDTRGLFVPTSIQKLVINVSDHVNLLSTLDEETPEYPVFVYKEVEVIKSGGVEIRGLKASAIPRKKPLGEPVLEKYKFIQNEGLKVKSPVKISPLVIKVSGVDFHWIPILQKALAAEETSTKQKIILLSQLEPLSGIIGFFNCIRKETGGERTRCFEILDKNAPPFNPEDPFYKVQVEKDLAVNILRNGQWGTYRHSILQPIKRVMTDHAYINALVRGDMSSLTWEQGPVNMKTWKKYSKDNINHDIAQIYYSSINFRDIMLTTAKLAPEVIESRRLYQHCVIGFEYSGRLRDSGKRVMGLTSGRSLANCCETDVEMAWEIPDQWTLEDAATVPCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMDAEIFTTVGTPEKREFIRKTFPFIKEENIGNSRDTSFEQLVMKRTKGRGVDLVLNSLAEEKLQASVRCLAQGGRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEWKMSLQKALQKAIDAGAVQPLVRTIFPEDKVEEAFRYMAAGKHIGKVIIKIRDEEPTKICTPKVKQLLAVPRYYADSNKSYIICGGLGGFGLELADWLVLRGARKLVLTSRSGVKNGYQALRIKIWKSYDVQVLISTDDITTEAGVVNLLTEANKLGPVDGIFNLAVVLKDALFENQTPEDFNASLGPKANATKYFDKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERICEARRAEGLPGLAVEWGAVGEVGLVADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEPIVASMVVAEKKAGSGGATNIVDAVINILGLRDLKTVSLHSTLAELGMDSMMAVEIKQTLEREFEVFLTPQDIRGLTFAKLQDIAVSFENDDKSKPVSTEASGGQVTALSVEDIPDVGIQYLMRTIGDEILANKPVIRLPSLKNNGSTVEEPVGNNNTIFMVPGIEGIATVLEPLAKNINAQVLVFQFDHTNPPDTIPEMADSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLEQLGTKCHLYLVDSAPDYVLTSLRKLPDWNAKLNYFLDLMPEDATHSRTYQRNLAHAAYKRITSILKYTDPKHKAFGGNITLLRPTEQALPTAEDYGLSKVCKKPVKVHFVDGNHFTVLDNIKSAQIIMHEDSTDFKTALFTSDDTGLNGTLS
***************************************************ASTALDRVYQRFQMAWETVSLMRGELYTEVPVVFENIKFMRATNVPKEGSVEFIVMVQKGSGNFEIVEGGAAIVTGKVYIPADVKTEMVRIPDQYKIPRTEGEAIELQSRDIYKELRLRGYHYKGLFRSLNVADGAGTQGKIRWHNNWVAFMDNMLQLQILQYDTRGLFVPTSIQKLVINVSDHVNLLSTLDEETPEYPVFVYKEVEVIKSGGVEIRGLKASAIPRKKPLGEPVLEKYKFIQNEGLKVKSPVKISPLVIKVSGVDFHWIPILQKALAAEETSTKQKIILLSQLEPLSGIIGFFNCIRKETGGERTRCFEILDKNAPPFNPEDPFYKVQVEKDLAVNILRNGQWGTYRHSILQPIKRVMTDHAYINALVRGDMSSLTWEQGPVNMKTWKKYSKDNINHDIAQIYYSSINFRDIMLTTAKLAPEVIESRRLYQHCVIGFEYSGRLRDSGKRVMGLTSGRSLANCCETDVEMAWEIPDQWTLEDAATVPCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMDAEIFTTVGTPEKREFIRKTFPFIKEENIGN***TSFEQLVMKRTKGRGVDLVLNSLAEEKLQASVRCLAQGGRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEWKMSLQKALQKAIDAGAVQPLVRTIFPEDKVEEAFRYMAAGKHIGKVIIKIRDEEPTKICTPKVKQLLAVPRYYADSNKSYIICGGLGGFGLELADWLVLRGARKLVLTSRSGVKNGYQALRIKIWKSYDVQVLISTDDITTEAGVVNLLTEANKLGPVDGIFNLAVVLKDALFENQTPEDFNASLGPKANATKYFDKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERICEARRAEGLPGLAVEWGAVGEVGLVADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEPIVASMVVAEKKAGSGGATNIVDAVINILGLRDLKTVSLHSTLAELGMDSMMAVEIKQTLEREFEVFLTPQDIRGLTFAKLQDIAVSF*****************VTALSVEDIPDVGIQYLMRTIGDEILANKPVIRLPSLKN***TVEEPVGNNNTIFMVPGIEGIATVLEPLAKNINAQVLVFQFDHTNPPDTIPEMADSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLEQLGTKCHLYLVDSAPDYVLTSLRKLPDWNAKLNYFLDLMPEDATHSRTYQRNLAHAAYKRITSILKYTDPKHKAFGGNITLLRPTEQALPTAEDYGLSKVCKKPVKVHFVDGNHFTVLDNIKSAQIIMHEDSTDFKTALF************
******************DVHIGTLLKEAP*******************RLASTALDRVYQRFQMAWETVSLMRGELYTEVPVVFENIKFMRATNVPKEGSVEFIVMVQKGSGNFEIVEGGAAIVTGKVYIPADVKTEMVR************EAIELQSRDIYKELRLRGYHYKGLFRSLNVADGAGTQGKIRWHNNWVAFMDNMLQLQILQYDTRGLFVPTSIQKLVINVSDHVNLLS*LDEETPEYPVFVYKEVEVIKSGGVEIRGLKASA********EPVLEKYKFIQNEGLKVKSPVKISPLVIKVSGVDFHWIPILQKALAAEETSTKQKIILLSQLEPLSGIIGFFNCIRKETGGERTRCFEILDKNAPPFNPEDPFYKVQVEKDLAVNILRNGQWGTYRHSI***********AYINALVRGDMSSLTWEQGPVNMKTWKKYSKDNINHDIAQIYYSSINFRDIMLTTAKLAPEVIESRRLYQHCVIGFEYSGRLRDSGKRVMGLTSGRSLANCCETDVEMAWEIPDQWTLEDAATVPCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMDAEIFTTVGTPEKREFIRKTFPFIKEENIGNSRDTSFEQLVMKRTKGRGVDLVLNSLAEEKLQASVRCLAQGGRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEWKMSLQKALQKAIDAGAVQPLVRTIFPEDKVEEAFRYMAAGKHIGKVIIKIRDEEP**********LLAVPRYYADSNKSYIICGGLGGFGLELADWLVLRGARKLVLTSRSGV****QALRIKIWKSYDVQVLISTDDITTEAGVVNLLTEANKLGPVDGIFNLAVVLKDALFENQTPEDFNASLGPKANATKYFDKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERICEARRAEGLPGLAVEWGAVGEVGLVADMAE**********LQQRISNCLECLNEFLIQSEPIVAS*************************************LAELGMDSMMAVEIKQTLEREFEVFLTPQDIRGLTFAKLQD**********************************GIQYLMRTIGDEILANKPVIRLPSL**********VGNNNTIFMVPGIEGIATVLEPLAKNINAQVLVFQFDHTNPPDTIPEMADSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLEQLGTKCHLYLVDSAPDYVLTSLRKLPDWNAKLNYFLDLMPEDATHSRTYQRNLAHAAYKRITSILKYTDPKHKAFGGNITLLRPTEQALPTAEDYGLSKVCKKPVKVHFVDGNHFTVLDNIKSAQIIMHEDSTDF*T**F************
****************DTDVHIGTLLKEAPRKGLVQLKNSFRSLSASPKRLASTALDRVYQRFQMAWETVSLMRGELYTEVPVVFENIKFMRATNVPKEGSVEFIVMVQKGSGNFEIVEGGAAIVTGKVYIPADVKTEMVRIPDQYKIPRTEGEAIELQSRDIYKELRLRGYHYKGLFRSLNVADGAGTQGKIRWHNNWVAFMDNMLQLQILQYDTRGLFVPTSIQKLVINVSDHVNLLSTLDEETPEYPVFVYKEVEVIKSGGVEIRGLKASAIPRKKPLGEPVLEKYKFIQNEGLKVKSPVKISPLVIKVSGVDFHWIPILQKALAAEETSTKQKIILLSQLEPLSGIIGFFNCIRKETGGERTRCFEILDKNAPPFNPEDPFYKVQVEKDLAVNILRNGQWGTYRHSILQPIKRVMTDHAYINALVRGDMSSLTWEQGPVNMKTWKKYSKDNINHDIAQIYYSSINFRDIMLTTAKLAPEVIESRRLYQHCVIGFEYSGRLRDSGKRVMGLTSGRSLANCCETDVEMAWEIPDQWTLEDAATVPCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMDAEIFTTVGTPEKREFIRKTFPFIKEENIGNSRDTSFEQLVMKRTKGRGVDLVLNSLAEEKLQASVRCLAQGGRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEWKMSLQKALQKAIDAGAVQPLVRTIFPEDKVEEAFRYMAAGKHIGKVIIKIRDEEPTKICTPKVKQLLAVPRYYADSNKSYIICGGLGGFGLELADWLVLRGARKLVLTSRSGVKNGYQALRIKIWKSYDVQVLISTDDITTEAGVVNLLTEANKLGPVDGIFNLAVVLKDALFENQTPEDFNASLGPKANATKYFDKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERICEARRAEGLPGLAVEWGAVGEVGLVADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEPIVASMVVAEKKAGSGGATNIVDAVINILGLRDLKTVSLHSTLAELGMDSMMAVEIKQTLEREFEVFLTPQDIRGLTFAKLQDIAVSFE****************VTALSVEDIPDVGIQYLMRTIGDEILANKPVIRLPSLKNNGSTVEEPVGNNNTIFMVPGIEGIATVLEPLAKNINAQVLVFQFDHTNPPDTIPEMADSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLEQLGTKCHLYLVDSAPDYVLTSLRKLPDWNAKLNYFLDLMPEDATHSRTYQRNLAHAAYKRITSILKYTDPKHKAFGGNITLLRPTEQALPTAEDYGLSKVCKKPVKVHFVDGNHFTVLDNIKSAQIIMHEDSTDFKTALFTSDDTGLNGTLS
***R*DVSSSSSEVKRDTDVHIGTLLKEAPRKGLVQLKNSFRSLSASPKRLASTALDRVYQRFQMAWETVSLMRGELYTEVPVVFENIKFMRATNVPKEGSVEFIVMVQKGSGNFEIVEGGAAIVTGKVYIPADVKTEMVRIPDQYKIPRTEGEAIELQSRDIYKELRLRGYHYKGLFRSLNVADGAGTQGKIRWHNNWVAFMDNMLQLQILQYDTRGLFVPTSIQKLVINVSDHVNLLSTLDEETPEYPVFVYKEVEVIKSGGVEIRGLKASAIPRKKPLGEPVLEKYKFIQNEGLKVKSPVKISPLVIKVSGVDFHWIPILQKALAAEETSTKQKIILLSQLEPLSGIIGFFNCIRKETGGERTRCFEILDKNAPPFNPEDPFYKVQVEKDLAVNILRNGQWGTYRHSILQPIKRVMTDHAYINALVRGDMSSLTWEQGPVNMKTWKKYSKDNINHDIAQIYYSSINFRDIMLTTAKLAPEVIESRRLYQHCVIGFEYSGRLRDSGKRVMGLTSGRSLANCCETDVEMAWEIPDQWTLEDAATVPCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMDAEIFTTVGTPEKREFIRKTFPFIKEENIGNSRDTSFEQLVMKRTKGRGVDLVLNSLAEEKLQASVRCLAQGGRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEWKMSLQKALQKAIDAGAVQPLVRTIFPEDKVEEAFRYMAAGKHIGKVIIKIRDEE****C**KVKQLLAVPRYYADSNKSYIICGGLGGFGLELADWLVLRGARKLVLTSRSGVKNGYQALRIKIWKSYDVQVLISTDDITTEAGVVNLLTEANKLGPVDGIFNLAVVLKDALFENQTPEDFNASLGPKANATKYFDKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERICEARRAEGLPGLAVEWGAVGEVGLVADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEPIVASMVVAEKKAGSGGATNIVDAVINILGLRDLKTVSLHSTLAELGMDSMMAVEIKQTLEREFEVFLTPQDIRGLTFAKLQDIAVSFE*******************L**EDIPDVGIQYLMRTIGDEILANKPVIRLPSLKNNGSTVEEPVGNNNTIFMVPGIEGIATVLEPLAKNINAQVLVFQFDHTNPPDTIPEMADSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLEQLGTKCHLYLVDSAPDYVLTSLRKLPDWNAKLNYFLDLMPEDATHSRTYQRNLAHAAYKRITSILKYTDPKHKAFGGNITLLRPTEQALPTAEDYGLSKVCKKPVKVHFVDGNHFTVLDNIKSAQIIMHEDSTDFKTALFTSD*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATRDDVSSSSSEVKRDTDVHIGTLLKEAPRKGLVQLKNSFRSLSASPKRLASTALDRVYQRFQMAWETVSLMRGELYTEVPVVFENIKFMRATNVPKEGSVEFIVMVQKGSGNFEIVEGGAAIVTGKVYIPADVKTEMVRIPDQYKIPRTEGEAIELQSRDIYKELRLRGYHYKGLFRSLNVADGAGTQGKIRWHNNWVAFMDNMLQLQILQYDTRGLFVPTSIQKLVINVSDHVNLLSTLDEETPEYPVFVYKEVEVIKSGGVEIRGLKASAIPRKKPLGEPVLEKYKFIQNEGLKVKSPVKISPLVIKVSGVDFHWIPILQKALAAEETSTKQKIILLSQLEPLSGIIGFFNCIRKETGGERTRCFEILDKNAPPFNPEDPFYKVQVEKDLAVNILRNGQWGTYRHSILQPIKRVMTDHAYINALVRGDMSSLTWEQGPVNMKTWKKYSKDNINHDIAQIYYSSINFRDIMLTTAKLAPEVIESRRLYQHCVIGFEYSGRLRDSGKRVMGLTSGRSLANCCETDVEMAWEIPDQWTLEDAATVPCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMDAEIFTTVGTPEKREFIRKTFPFIKEENIGNSRDTSFEQLVMKRTKGRGVDLVLNSLAEEKLQASVRCLAQGGRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEWKMSLQKALQKAIDAGAVQPLVRTIFPEDKVEEAFRYMAAGKHIGKVIIKIRDEEPTKICTPKVKQLLAVPRYYADSNKSYIICGGLGGFGLELADWLVLRGARKLVLTSRSGVKNGYQALRIKIWKSYDVQVLISTDDITTEAGVVNLLTEANKLGPVDGIFNLAVVLKDALFENQTPEDFNASLGPKANATKYFDKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERICEARRAEGLPGLAVEWGAVGEVGLVADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEPIVASMVVAEKKAGSGGATNIVDAVINILGLRDLKTVSLHSTLAELGMDSMMAVEIKQTLEREFEVFLTPQDIRGLTFAKLQDIAVSFENDDKSKPVSTEASGGQVTALSVEDIPDVGIQYLMRTIGDEILANKPVIRLPSLKNNGSTVEEPVGNNNTIFMVPGIEGIATVLEPLAKNINAQVLVFQFDHTNPPDTIPEMADSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLEQLGTKCHLYLVDSAPDYVLTSLRKLPDWNAKLNYFLDLMPEDATHSRTYQRNLAHAAYKRITSILKYTDPKHKAFGGNITLLRPTEQALPTAEDYGLSKVCKKPVKVHFVDGNHFTVLDNIKSAQIIMHEDSTDFKTALFTSDDTGLNGTLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1392 2.2.26 [Sep-21-2011]
P190962504 Fatty acid synthase OS=Mu yes N/A 0.732 0.407 0.425 0.0
P122762512 Fatty acid synthase OS=Ga yes N/A 0.738 0.409 0.419 0.0
P127852505 Fatty acid synthase OS=Ra yes N/A 0.734 0.407 0.417 0.0
Q71SP72513 Fatty acid synthase OS=Bo yes N/A 0.732 0.405 0.410 0.0
P493272511 Fatty acid synthase OS=Ho yes N/A 0.728 0.403 0.411 0.0
P962022188 Phthiocerol synthesis pol yes N/A 0.443 0.282 0.288 1e-58
Q7TXL82188 Phthiocerol/phenolphthioc yes N/A 0.443 0.282 0.288 1e-58
B2HIL72104 Phenolphthiocerol synthes no N/A 0.322 0.213 0.305 1e-50
Q022512111 Mycocerosic acid synthase no N/A 0.370 0.244 0.313 1e-49
Q54FI3 2968 Probable polyketide synth yes N/A 0.357 0.167 0.282 2e-49
>sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 Back     alignment and function desciption
 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/1123 (42%), Positives = 674/1123 (60%), Gaps = 103/1123 (9%)

Query: 307  PLVIKVSGVDFHWIPILQKALAAEETSTKQKIILLSQLEPLSGIIGFFNCIRKETGGERT 366
            P+ + V    F W+  L+  LA   TS+ Q + L +   P SG++G  NC+RKE GG R 
Sbjct: 1406 PIFLSVEDTSFQWVDSLKSTLA---TSSSQPVWLTAMDCPTSGVVGLVNCLRKEPGGHRI 1462

Query: 367  RCFEILD----KNAPPFNPEDPFYKVQVEKDLAVNILRNGQWGTYRHSILQPIK-RVMTD 421
            RC  + +     +AP  +P  P  +  ++ DL +N+ R+G WG +RH  L+  K +  T 
Sbjct: 1463 RCILLSNLSNTSHAPKLDPGSPELQQVLKHDLVMNVYRDGAWGAFRHFQLEQDKPKEQTA 1522

Query: 422  HAYINALVRGDMSSLTWEQGPVNMKTWKKYSKDNINHDIAQIYYSSINFRDIMLTTAKLA 481
            HA++N L RGD++S+ W   P+     K     +    +  +YY+S+NFRDIML T KL+
Sbjct: 1523 HAFVNVLTRGDLASIRWVSSPL-----KHTQPSSSGAQLCTVYYASLNFRDIMLATGKLS 1577

Query: 482  PEVIESRRLYQHCVIGFEYSGRLRDSGKRVMGLTSGRSLANCCETDVEMAWEIPDQWTLE 541
            P+ I  +   + C++G E+SGR R  G+RVMGL     LA       +  W++P  WTLE
Sbjct: 1578 PDAIPGKWASRDCMLGMEFSGRDR-CGRRVMGLVPAEGLATSVLLSSDFLWDVPSSWTLE 1636

Query: 542  DAATVPCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMDAEIFTTVGTPE 601
            +AA+VP VY TA Y++ + G++Q+GE++LIH+GSGGVGQAAI++A  +   +FTTVG+ E
Sbjct: 1637 EAASVPVVYTTAYYSLVVRGRIQRGETVLIHSGSGGVGQAAISIALSLGCRVFTTVGSAE 1696

Query: 602  KREFIRKTFPFIKEENIGNSRDTSFEQLVMKRTKGRGVDLVLNSLAEEKLQASVRCLAQG 661
            KR +++  FP + + +  NSRDTSFEQ V+  T G+GVDLVLNSLAEEKLQASVRCLAQ 
Sbjct: 1697 KRAYLQARFPQLDDTSFANSRDTSFEQHVLLHTGGKGVDLVLNSLAEEKLQASVRCLAQH 1756

Query: 662  GRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFF-FAEQEWKMSLQKALQKAIDAGA 720
            GRFLEIGKFDL+NN+ LGM +F++  +FHG++LD  F  A   W+  +   L+  I  G 
Sbjct: 1757 GRFLEIGKFDLSNNHPLGMAIFLKNVTFHGILLDALFEEANDSWR-EVAALLKAGIRDGV 1815

Query: 721  VQPLVRTIFPEDKVEEAFRYMAAGKHIGKVIIKIRDEEPTKICTPKVKQLL-AVPRYYAD 779
            V+PL  T+FP+ +VE+AFRYMA GKHIGKV++++R+EEP  +       L+ A+ + +  
Sbjct: 1816 VKPLKCTVFPKAQVEDAFRYMAQGKHIGKVLVQVREEEPEAVLPGAQPTLISAISKTFCP 1875

Query: 780  SNKSYIICGGLGGFGLELADWLVLRGARKLVLTSRSGVKNGYQALRIKIWKSYDVQVLIS 839
            ++KSYII GGLGGFGLELA WLVLRGA++LVLTSRSG++ GYQA  I+ W+   +QVL+S
Sbjct: 1876 AHKSYIITGGLGGFGLELARWLVLRGAQRLVLTSRSGIRTGYQAKHIREWRRQGIQVLVS 1935

Query: 840  TDDITTEAGVVNLLTEANKLGPVDGIFNLAVVLKDALFENQTPEDFNASLGPKANATKYF 899
            T ++++  G   L+ EA KLGPV G+FNLA+VL+DA+ ENQTPE F     PK N T   
Sbjct: 1936 TSNVSSLEGARALIAEATKLGPVGGVFNLAMVLRDAMLENQTPELFQDVNKPKYNGTLNL 1995

Query: 900  DKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERICEARRAEGLPGLAVEWGA 959
            D+ +R  CP L  FV FSSVSCGRGNAGQTNYG ANS MERICE RR +GLPGLAV+WGA
Sbjct: 1996 DRATREACPELDYFVAFSSVSCGRGNAGQTNYGFANSTMERICEQRRHDGLPGLAVQWGA 2055

Query: 960  VGEVGLVADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEPIVASMVVAEKKAGSGG- 1018
            +G+VG+V +    N + VIGGTL QRIS+C+E L+ FL Q   +++S V+AEKKA + G 
Sbjct: 2056 IGDVGIVLEAMGTN-DTVIGGTLPQRISSCMEVLDLFLNQPHAVLSSFVLAEKKAVAHGD 2114

Query: 1019 ---ATNIVDAVINILGLRDLKTVSLHSTLAELGMDSMMAVEIKQTLEREFEVFLTPQDIR 1075
                 ++V AV +ILG+RDL  ++L STLA+LG+DS+M VE++Q LERE ++ L  +++R
Sbjct: 2115 GDTQRDLVKAVAHILGIRDLAGINLDSTLADLGLDSLMGVEVRQILEREHDLVLPMREVR 2174

Query: 1076 GLTFAKLQDIAVSFEN-DDKSKPVSTEASGGQVTALSVEDIPDVGIQYLMRTIGDEILAN 1134
             LT  KLQ+++   ++  D + P S   +  +   L++                  +L N
Sbjct: 2175 QLTLRKLQEMSSKTDSATDTTAPKSRSDTSLKQNQLNL----------------STLLVN 2218

Query: 1135 KPVIRLPSLKNNGSTVEEPVGNNNTIFMVPGIEGIATVLEPLAKNINAQVLVFQFDHTNP 1194
                 L  L N+  + E P      +F+V  IEG  TV   LA  ++      Q     P
Sbjct: 2219 PEGPTLTQL-NSVQSSERP------LFLVHPIEGSTTVFHSLAAKLSVPTYGLQCTQAAP 2271

Query: 1195 PDTIPEMADSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLE-QLG---TKCHLYL 1250
             D+IP +A   +   K+  V      ++ G+SFG  VA E+  +L+ Q G   T  +L+L
Sbjct: 2272 LDSIPNLAAYYIDCIKQ--VQPEGPYRIAGYSFGACVAFEMCSQLQAQQGPAPTHNNLFL 2329

Query: 1251 VDSAPDYVLTSLRKLPDWNAKLN-----------------YFLD---------LMP---- 1280
             D +  YVL   +    + AK+                   FLD         L+P    
Sbjct: 2330 FDGSHTYVLAYTQS---YRAKMTPGCEAEAEAEALCFFIKQFLDVEHSKVLEALLPLKSL 2386

Query: 1281 ED----------ATHSRTYQRNLAHAA---YKRITSILKYTDPKHKAFGGNITLLRPTEQ 1327
            ED           +H    +R L+ AA   Y ++ +  +Y  PK K + GN+TLLR    
Sbjct: 2387 EDRVAASVDLITKSHHSLDRRELSFAAVSFYHKLRAADQY-KPKAK-YHGNVTLLRAKTG 2444

Query: 1328 AL---PTAEDYGLSKVCKKPVKVHFVDGNHFTVLDNIKSAQII 1367
                     DY LS+VC   V VH ++G+H T+L+      II
Sbjct: 2445 GTYGEDLGADYNLSQVCDGKVSVHIIEGDHRTLLEGSGLESII 2487




Fatty acid synthetase catalyzes the formation of long-chain fatty acids from acetyl-CoA, malonyl-CoA and NADPH. This multifunctional protein has 7 catalytic activities and an acyl carrier protein.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: 1EC: 4
>sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 Back     alignment and function description
>sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 Back     alignment and function description
>sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 Back     alignment and function description
>sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 Back     alignment and function description
>sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis GN=ppsC PE=1 SV=2 Back     alignment and function description
>sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 Back     alignment and function description
>sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 Back     alignment and function description
>sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 Back     alignment and function description
>sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1392
328721179 2404 PREDICTED: fatty acid synthase-like [Acy 0.765 0.443 0.554 0.0
242018452 2428 fatty acid synthase, putative [Pediculus 0.753 0.432 0.498 0.0
156549724 3088 PREDICTED: fatty acid synthase-like [Nas 0.744 0.335 0.492 0.0
156549726 2406 PREDICTED: fatty acid synthase-like [Nas 0.744 0.431 0.490 0.0
357631736 2420 p270 [Danaus plexippus] 0.781 0.449 0.456 0.0
112984340 2422 p270 [Bombyx mori] gi|2058460|gb|AAB5325 0.736 0.423 0.472 0.0
307213875 2408 Fatty acid synthase [Harpegnathos saltat 0.741 0.428 0.479 0.0
157118100 2385 fatty acid synthase [Aedes aegypti] gi|1 0.749 0.437 0.455 0.0
390179170 2367 GA26263 [Drosophila pseudoobscura pseudo 0.746 0.438 0.451 0.0
170044457 2386 fatty acid synthase S-acetyl transferase 0.75 0.437 0.453 0.0
>gi|328721179|ref|XP_001949072.2| PREDICTED: fatty acid synthase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 1251 bits (3236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/1125 (55%), Positives = 808/1125 (71%), Gaps = 60/1125 (5%)

Query: 293  QNEGLKVKSPVK--ISPLVIKVSGVDFHWIPILQKALAAEETSTKQKIILLSQLEPLSGI 350
            Q   + V+ P++  I P+V+K+S  +F W+P+LQK L A++ S  QKI+L+ + +P +GI
Sbjct: 1297 QERLMLVRKPLEQNIVPIVVKISSTEFSWLPVLQKLLKADDASVSQKIVLVGEKDPKNGI 1356

Query: 351  IGFFNCIRKETGGERTRCFEILDKNAPPFNPEDPFYKVQVEKDLAVNILRNGQWGTYRHS 410
            +G  NCIRKE GG+R RC  I+DK AP F+ ++P YK Q+ KDL +N+ +N  WG+YRH 
Sbjct: 1357 VGLLNCIRKEPGGDRVRCVFIMDKCAPIFSLDEPLYKKQLNKDLILNVYKNKVWGSYRHL 1416

Query: 411  ILQPIKRVMTDHAYINALVRGDMSSLTWEQGPVNMKTWKKYSKDNINHDIAQIYYSSINF 470
            +L+P   +   H+ +N  +RGD+SSL W QG +       ++K     D+  +YY+++NF
Sbjct: 1417 LLEPPSLIEVQHSCVNTSIRGDLSSLKWFQGSI-----VPFTKPPAESDLVHVYYTALNF 1471

Query: 471  RDIMLTTAKLAPEVIESRRLYQHCVIGFEYSGRLRDSGKRVMGLTSGRSLANCCETDVEM 530
            RDIML TAKLAPEVI   R+ Q  VIGFEYSGR R++G+R+MG+ + R+L N    D  +
Sbjct: 1472 RDIMLATAKLAPEVIARGRINQESVIGFEYSGR-RENGERIMGMITSRALTNILVHDKYL 1530

Query: 531  AWEIPDQWTLEDAATVPCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMD 590
            AW++PD W+LE+AATVP VY T +YA+ + G+M++G+S+LIHAG+GGVGQAAI +A Y +
Sbjct: 1531 AWKVPDSWSLEEAATVPVVYGTVIYALIVSGRMKRGDSVLIHAGTGGVGQAAITIALYYE 1590

Query: 591  AEIFTTVGTPEKREFIRKTFPFIKEENIGNSRDTSFEQLVMKRTKGRGVDLVLNSLAEEK 650
             EIFTTVGT EKREFI+  FP I E +IGNSRD+SFEQ++M  T G+GVD+VLNSLAEEK
Sbjct: 1591 CEIFTTVGTAEKREFIKTHFPQIPESHIGNSRDSSFEQMIMMETDGKGVDMVLNSLAEEK 1650

Query: 651  LQASVRCLAQGGRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEWKMSLQK 710
            L ASVRCLA GGRFLEIGKFDLANN+M+GME+F++E SFHGVMLD  F +  EWK   Q+
Sbjct: 1651 LLASVRCLATGGRFLEIGKFDLANNSMIGMELFLKEISFHGVMLDTLFESPDEWKEVFQR 1710

Query: 711  ALQKAIDAGAVQPLVRTIFPEDKVEEAFRYMAAGKHIGKVIIKIRDEEPTKICTPKVKQL 770
             +Q+ ID+GA++PLVRT+F  D+VE AFRYMAAGKHIGKV+IKIRDEE  +   P+   +
Sbjct: 1711 QVQENIDSGAIRPLVRTVFESDQVEPAFRYMAAGKHIGKVLIKIRDEEEDRFIKPRSINV 1770

Query: 771  LAVPRYYADSNKSYIICGGLGGFGLELADWLVLRGARKLVLTSRSGVKNGYQALRIKIWK 830
             A PR   D N S IICGGLGGFGLELADW+VLR +R ++LT+R+G++NGYQALR ++W+
Sbjct: 1771 KAYPRVTFDKNSSCIICGGLGGFGLELADWMVLRNSRNIILTTRTGIRNGYQALRKRVWE 1830

Query: 831  SYDVQVLISTDDITTEAGVVNLLTEANKLGPVDGIFNLAVVLKDALFENQTPEDFNASLG 890
            SY   V+IST DITTE GV  LL EANKLGPV  IFNLAVVLKDALFENQT EDF AS G
Sbjct: 1831 SYGANVVISTADITTEEGVKQLLNEANKLGPVSTIFNLAVVLKDALFENQTEEDFKASFG 1890

Query: 891  PKANATKYFDKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERICEARRAEGL 950
            PKA AT   DKYSRTMCP L  FV+FSSVSCGRGNAGQTNYGM+NS+MERICE R +EGL
Sbjct: 1891 PKAIATSLLDKYSRTMCPELKHFVIFSSVSCGRGNAGQTNYGMSNSVMERICEIRHSEGL 1950

Query: 951  PGLAVEWGAVGEVGLVADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQ-SEPIVASMVV 1009
            P LAVEWGAVGEVGLVADMAEDN EVVIGGTLQQ+I NCLE L++ L Q + PIV+SMVV
Sbjct: 1951 PALAVEWGAVGEVGLVADMAEDNQEVVIGGTLQQKIGNCLEILDDLLTQKNNPIVSSMVV 2010

Query: 1010 AEKKAGSGGATNIVDAVINILGLRDLKTVSLHSTLAELGMDSMMAVEIKQTLEREFEVFL 1069
            AEK+A S  A  IVD VINILGLRDLKT+SLHSTLAELGMDSMMAVEIKQTLER+FEVFL
Sbjct: 2011 AEKRASSSNAGTIVDTVINILGLRDLKTISLHSTLAELGMDSMMAVEIKQTLERQFEVFL 2070

Query: 1070 TPQDIRGLTFAKLQDIAVSFENDDKSKPVSTEASGGQVTALSVEDIPDVGIQYLMRTIGD 1129
            TPQDIR +TFAKLQ+I  S   DDK K    ++        S+  +PDVG+ YL+R IG+
Sbjct: 2071 TPQDIRSMTFAKLQEIGSS---DDKEKKADVDSK-------SIVQVPDVGLGYLIRAIGE 2120

Query: 1130 EILANKPVIRLPSLKNNGSTVEEPVGNNNTIFMVPGIEGIATVLEPLAKNINAQVLVFQF 1189
            E  A   V+R+PSL  +GS VE+P    NT+F++PG+EGI+++LEPL++N+N QVL  Q+
Sbjct: 2121 ESSAYNSVMRIPSLCEDGSVVEQPTTKLNTLFVIPGLEGISSMLEPLSRNLNMQVLCLQY 2180

Query: 1190 DHTNPPDTIPEMADSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLEQLGTKCHLY 1249
            D      TI EMA +     ++RL     E  +VG+SFGG++A+E+   LE+      L+
Sbjct: 2181 DILGTASTIEEMAATHYTLIQERL-SADQEFSIVGYSFGGLIAIEVLKMLEKNNRTGKLW 2239

Query: 1250 LVDSAPDY--------------------------------------VLTSLRKLPDWNAK 1271
            L+DSAP +                                      + T L ++  W+ +
Sbjct: 2240 LIDSAPQFLKMTTELAIRGDKAQDQEIQVQLILRFLDLVWPHNKTKITTELYQINSWDER 2299

Query: 1272 LNYFLDLMPEDATHSRTYQRNLAHAAYKRITSILKYTDPKHKAFGGNITLLRPTEQALPT 1331
            LNYF++ +P+D  +S+ YQ+ L + AY ++ +++ Y    + +      L+RPTEQ LP 
Sbjct: 2300 LNYFIEQVPDDVIYSKIYQKQLLNCAYIKLKALINYDGKPNGSLKTRTLLIRPTEQVLPI 2359

Query: 1332 AEDYGLSKVCKKPVKVHFVDGNHFTVLDNIKSAQIIMHEDSTDFK 1376
            +EDYGLS+     V VHFV+GNH+++L+N K A++I    S+ FK
Sbjct: 2360 SEDYGLSEYFNSAVMVHFVEGNHYSILENKKVAELI--SQSSSFK 2402




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242018452|ref|XP_002429689.1| fatty acid synthase, putative [Pediculus humanus corporis] gi|212514692|gb|EEB16951.1| fatty acid synthase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|156549724|ref|XP_001605685.1| PREDICTED: fatty acid synthase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|156549726|ref|XP_001605700.1| PREDICTED: fatty acid synthase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|357631736|gb|EHJ79205.1| p270 [Danaus plexippus] Back     alignment and taxonomy information
>gi|112984340|ref|NP_001037478.1| p270 [Bombyx mori] gi|2058460|gb|AAB53258.1| p270 [Bombyx mori] Back     alignment and taxonomy information
>gi|307213875|gb|EFN89136.1| Fatty acid synthase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|157118100|ref|XP_001659008.1| fatty acid synthase [Aedes aegypti] gi|108875860|gb|EAT40085.1| AAEL008160-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|390179170|ref|XP_002137899.2| GA26263 [Drosophila pseudoobscura pseudoobscura] gi|388859741|gb|EDY68457.2| GA26263 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|170044457|ref|XP_001849863.1| fatty acid synthase S-acetyl transferase [Culex quinquefasciatus] gi|167867603|gb|EDS30986.1| fatty acid synthase S-acetyl transferase [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1392
FB|FBgn00275712544 CG3523 [Drosophila melanogaste 0.672 0.367 0.473 1.4e-289
FB|FBgn00400012394 CG17374 [Drosophila melanogast 0.666 0.387 0.473 1.7e-282
ZFIN|ZDB-GENE-030131-78022514 fasn "fatty acid synthase" [Da 0.568 0.314 0.495 2.1e-268
FB|FBgn00426272409 v(2)k05816 "v(2)k05816" [Droso 0.743 0.429 0.441 2e-263
MGI|MGI:954852504 Fasn "fatty acid synthase" [Mu 0.561 0.312 0.493 4.1e-261
RGD|6206652505 Fasn "fatty acid synthase" [Ra 0.556 0.309 0.491 6.7e-257
UNIPROTKB|P127852505 Fasn "Fatty acid synthase" [Ra 0.556 0.309 0.491 6.7e-257
UNIPROTKB|F1N8A82512 FASN "Fatty acid synthase" [Ga 0.576 0.319 0.486 2e-255
UNIPROTKB|E1BW072513 FASN "Fatty acid synthase" [Ga 0.576 0.319 0.485 1.8e-254
UNIPROTKB|P122762512 FASN "Fatty acid synthase" [Ga 0.576 0.319 0.483 1.3e-253
FB|FBgn0027571 CG3523 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 2196 (778.1 bits), Expect = 1.4e-289, Sum P(3) = 1.4e-289
 Identities = 452/955 (47%), Positives = 612/955 (64%)

Query:   308 LVIKVSGVDFHWIPILQKALAAEETSTKQKIILLSQLEPLSGIIGFFNCIRKETGGERTR 367
             +V+  +  +F+W+  L+ ALA   T  +Q + ++ Q E L G +G   CI+ E GG+  R
Sbjct:  1448 VVVVATEQNFNWVDDLKAALATAATE-EQYVYVVCQGEELFGAVGLMTCIKNENGGKLAR 1506

Query:   368 CFEILDKNAPPFNPEDPFYKVQVEKDLAVNILRNGQWGTYRHSILQPIKRVM-TDHAYIN 426
                + D  A  F+     Y+ Q+EKDL  N+L+NG WGT+RH  L+  +  +  +HAY+N
Sbjct:  1507 LVFVQDAKAEKFSLTSTLYRQQLEKDLISNVLKNGAWGTFRHLKLETQQATLQVEHAYVN 1566

Query:   427 ALVRGDMSSLTWEQGPVNMKTWKKYSKDNINHDIAQIYYSSINFRDIMLTTAKLAPEVIE 486
             ALV+GD++SL W +      T     K   N +   +YY+ INFRD+MLT+ KLA + + 
Sbjct:  1567 ALVKGDLASLKWIEA-AQADTAATVDK---NLETCTVYYAPINFRDVMLTSGKLAADALP 1622

Query:   487 SRRLYQHCVIGFEYSGRLRDSGKRVMGLTSGRSLANCCETDVEMAWEIPDQWTLEDAATV 546
                  Q CV+G E++GR    G+RVM +   +SLA  C     M W+IP++WT+E+A+TV
Sbjct:  1623 GDLAEQDCVLGLEFAGR-DTQGRRVMAMVPAKSLATTCVASKRMMWQIPEKWTMEEASTV 1681

Query:   547 PCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMDAEIFTTVGTPEKREFI 606
             PCVY+T  YA+ + GQM+KGE ILIHAGSGGVGQAAI++A      +FTTVG+ EKREF+
Sbjct:  1682 PCVYSTVYYALVVRGQMKKGEKILIHAGSGGVGQAAISVALAHGLTVFTTVGSKEKREFL 1741

Query:   607 RKTFPFIKEENIGNSRDTSFEQLVMKRTKGRGVDLVLNSLAEEKLQASVRCLAQGGRFLE 666
              K FP ++E NIGNSRDTSFEQLV++ TKGRGVDLVLNSL+EEKLQAS+RCL   GRFLE
Sbjct:  1742 LKRFPKLQERNIGNSRDTSFEQLVLRETKGRGVDLVLNSLSEEKLQASIRCLGLNGRFLE 1801

Query:   667 IGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEWKMSLQKALQKAIDAGAVQPLVR 726
             IGKFDL+NN+ LGM VF++ TSFHG++LD+    E+E +  +   + + I  GAV PL  
Sbjct:  1802 IGKFDLSNNSPLGMSVFLKNTSFHGILLDSVMEGEEEMQNQVVSLVAEGIKTGAVVPLPT 1861

Query:   727 TIFPEDKVEEAFRYMAAGKHIGKVIIKIRDEEP-TKICTPKVKQLLAVPRYYADSNKSYI 785
             ++F + +VE+AFR+MA+GKHIGKV+IK+RDEE   K   PK + + A+PR Y    KSYI
Sbjct:  1862 SVFNDQQVEQAFRFMASGKHIGKVVIKVRDEEAGKKALQPKPRLINAIPRTYMHPEKSYI 1921

Query:   786 ICGGLGGFGLELADWLVLRGARKLVLTSRSGVKNGYQALRIKIWKSYDVQVLISTDDITT 845
             + GGLGGFGLEL +WLV RGAR +VLTSRSGVK GYQ L I+ W+   V+V+I T D+TT
Sbjct:  1922 LVGGLGGFGLELTNWLVTRGARYIVLTSRSGVKTGYQGLMIRRWQERGVKVVIDTSDVTT 1981

Query:   846 EAGVVNLLTEANKLGPVDGIFNLAVVLKDALFENQTPEDFNASLGPKANATKYFDKYSRT 905
              AG   LL  +NKL  V GIFNLA VL+DAL E+QT +DF     PK  ATKY D++SR 
Sbjct:  1982 AAGAKKLLENSNKLALVGGIFNLAAVLRDALIEDQTAKDFKTVADPKVTATKYLDQFSRD 2041

Query:   906 MCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERICEARRAEGLPGLAVEWGAVGEVGL 965
             +C  L  F+ FSSVSCGRGN GQTNYG+ANS MERICE R+  G PG A++WGA+G+ GL
Sbjct:  2042 ICTELDYFICFSSVSCGRGNIGQTNYGLANSAMERICEQRQVSGFPGTAIQWGAIGDTGL 2101

Query:   966 VADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEPIVASMVVAEK-KAGSGGATNIVD 1024
             V +   DN + VIGGTL QR+ +CL+ ++ FL Q  P+VASMVVAEK K+      +++ 
Sbjct:  2102 VLENLGDN-DTVIGGTLPQRMPSCLQTIDLFLQQPHPVVASMVVAEKRKSDQSAGVSLIA 2160

Query:  1025 AVINILGLRDLKTVSLHSTLAELGMDSMMAVEIKQTLEREFEVFLTPQDIRGLTFAKLQD 1084
              + NILGLRD K +   ++LA+LGMDS+M+ EIKQTLER F++ L+ Q+IR LTF  L+ 
Sbjct:  2161 TIANILGLRDTKNIQDGASLADLGMDSLMSAEIKQTLERNFDIVLSAQEIRQLTFGALK- 2219

Query:  1085 IAVSFENDDKSKPVSTEASGGQVTALSVEDIPDVGIQYLMRTIGDEILANKPVIRLPSLK 1144
              A+    D K    +  A+ G   A    +I   G       +GD          +P+  
Sbjct:  2220 -AMDGGADVKPAAAAPAAAAGVPEA----NITSGGSSRTASPMGDGTQVVFTTSLIPTEA 2274

Query:  1145 NNGSTVEEPVGNNNT-IFMVPGIEGIATVLEPLAKNINAQVLVFQFDHTNPPDTIPEMAD 1203
                   + P  +  + IF +  IEG A+ LEPLAK +       Q+    P D++   A 
Sbjct:  2275 IVQLDTKAPANSKQSPIFFISPIEGFASALEPLAKRLEVPAYGLQYTEAVPSDSLESAAK 2334

Query:  1204 SLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLEQLGTKCHLYLVDSAPDYV 1258
               +     R V      KL G+SFG ++   +A  LE+     ++ ++D AP YV
Sbjct:  2335 FFIKQL--RTVQPKGPYKLAGYSFGCLLTYVMAGILEETNEVANVIMLDGAPSYV 2387


GO:0004312 "fatty acid synthase activity" evidence=ISS
GO:0016295 "myristoyl-[acyl-carrier-protein
GO:0009058 "biosynthetic process" evidence=IEA
GO:0004314 "[acyl-carrier-protein
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004313 "[acyl-carrier-protein
GO:0004316 "3-oxoacyl-[acyl-carrier-protein
GO:0016296 "palmitoyl-[acyl-carrier-protein
GO:0004320 "oleoyl-[acyl-carrier-protein
GO:0004317 "3-hydroxypalmitoyl-[acyl-carrier-protein
GO:0004319 "enoyl-[acyl-carrier-protein
GO:0004315 "3-oxoacyl-[acyl-carrier-protein
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
FB|FBgn0040001 CG17374 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7802 fasn "fatty acid synthase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0042627 v(2)k05816 "v(2)k05816" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:95485 Fasn "fatty acid synthase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620665 Fasn "fatty acid synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P12785 Fasn "Fatty acid synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8A8 FASN "Fatty acid synthase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BW07 FASN "Fatty acid synthase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P12276 FASN "Fatty acid synthase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!
3rd Layer1.3.1.10LOW CONFIDENCE prediction!
3rd Layer2.3.1.380.737

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1392
smart00829287 smart00829, PKS_ER, Enoylreductase 1e-117
cd05195293 cd05195, enoyl_red, enoyl reductase of polyketide 1e-107
cd08954452 cd08954, KR_1_FAS_SDR_x, beta-ketoacyl reductase ( 3e-77
smart00822180 smart00822, PKS_KR, This enzymatic domain is part 1e-57
cd05274375 cd05274, KR_FAS_SDR_x, ketoreductase (KR) and fatt 5e-53
cd05276323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 7e-50
pfam08659181 pfam08659, KR, KR domain 2e-49
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 4e-49
cd08241323 cd08241, QOR1, Quinone oxidoreductase (QOR) 2e-46
cd08251303 cd08251, polyketide_synthase, polyketide synthase 9e-46
cd08955376 cd08955, KR_2_FAS_SDR_x, beta-ketoacyl reductase ( 5e-40
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 6e-40
cd08266342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 1e-39
TIGR02824325 TIGR02824, quinone_pig3, putative NAD(P)H quinone 3e-39
cd08275337 cd08275, MDR3, Medium chain dehydrogenases/reducta 5e-35
cd08272326 cd08272, MDR6, Medium chain dehydrogenases/reducta 9e-32
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 3e-30
cd08253325 cd08253, zeta_crystallin, Zeta-crystallin with NAD 5e-30
cd08953436 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 1e-29
cd08276336 cd08276, MDR7, Medium chain dehydrogenases/reducta 5e-29
cd08268328 cd08268, MDR2, Medium chain dehydrogenases/reducta 1e-27
PTZ00354334 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi 6e-27
cd05289309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 6e-27
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reducta 9e-27
cd08271325 cd08271, MDR5, Medium chain dehydrogenases/reducta 2e-25
cd08952480 cd08952, KR_1_SDR_x, ketoreductase (KR), subgroup 2e-23
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 1e-21
cd08956448 cd08956, KR_3_FAS_SDR_x, beta-ketoacyl reductase ( 2e-21
cd05286320 cd05286, QOR2, Quinone oxidoreductase (QOR) 8e-21
cd08273331 cd08273, MDR8, Medium chain dehydrogenases/reducta 1e-18
cd08249339 cd08249, enoyl_reductase_like, enoyl_reductase_lik 8e-18
pfam00107131 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase 5e-16
cd08250329 cd08250, Mgc45594_like, Mgc45594 gene product and 2e-15
pfam13602129 pfam13602, ADH_zinc_N_2, Zinc-binding dehydrogenas 4e-15
COG1064339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 4e-15
cd08244324 cd08244, MDR_enoyl_red, Possible enoyl reductase 4e-15
cd05278347 cd05278, FDH_like, Formaldehyde dehydrogenases 4e-14
pfam00975224 pfam00975, Thioesterase, Thioesterase domain 4e-14
cd05282323 cd05282, ETR_like, 2-enoyl thioester reductase-lik 8e-14
cd08248350 cd08248, RTN4I1, Human Reticulon 4 Interacting Pro 9e-14
PRK13771334 PRK13771, PRK13771, putative alcohol dehydrogenase 2e-13
COG2130340 COG2130, COG2130, Putative NADP-dependent oxidored 8e-13
cd08243320 cd08243, quinone_oxidoreductase_like_1, Quinone ox 1e-12
COG1063350 COG1063, Tdh, Threonine dehydrogenase and related 3e-12
cd05288329 cd05288, PGDH, Prostaglandin dehydrogenases 3e-12
cd08274350 cd08274, MDR9, Medium chain dehydrogenases/reducta 5e-12
cd08260345 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD 9e-12
cd08235343 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas 2e-11
cd08270305 cd08270, MDR4, Medium chain dehydrogenases/reducta 1e-10
cd08263367 cd08263, Zn_ADH10, Alcohol dehydrogenases of the M 1e-10
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 6e-10
TIGR01751398 TIGR01751, crot-CoA-red, crotonyl-CoA reductase 7e-10
cd08246393 cd08246, crotonyl_coA_red, crotonyl-CoA reductase 2e-09
COG1028251 COG1028, FabG, Dehydrogenases with different speci 2e-09
cd08254338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 4e-09
cd08954452 cd08954, KR_1_FAS_SDR_x, beta-ketoacyl reductase ( 1e-08
cd05233234 cd05233, SDR_c, classical (c) SDRs 1e-08
cd08261337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 2e-08
cd08236343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 2e-08
smart0082386 smart00823, PKS_PP, Phosphopantetheine attachment 2e-08
PRK09072263 PRK09072, PRK09072, short chain dehydrogenase; Pro 3e-08
COG3319257 COG3319, COG3319, Thioesterase domains of type I p 3e-08
cd08231361 cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 5e-08
cd08297341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA 8e-08
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 1e-07
cd08239339 cd08239, THR_DH_like, L-threonine dehydrogenase (T 1e-07
cd08247352 cd08247, AST1_like, AST1 is a cytoplasmic protein 2e-07
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 3e-07
PRK10754327 PRK10754, PRK10754, quinone oxidoreductase, NADPH- 3e-07
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-07
cd08245330 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD 4e-07
cd05285343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 5e-07
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 8e-07
cd08258306 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD 1e-06
TIGR028132582 TIGR02813, omega_3_PfaA, polyketide-type polyunsat 1e-06
COG1062366 COG1062, AdhC, Zn-dependent alcohol dehydrogenases 2e-06
cd02266186 cd02266, SDR, Short-chain dehydrogenases/reductase 2e-06
pfam0055066 pfam00550, PP-binding, Phosphopantetheine attachme 7e-06
cd08279363 cd08279, Zn_ADH_class_III, Class III alcohol dehyd 8e-06
cd05281341 cd05281, TDH, Threonine dehydrogenase 9e-06
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 1e-05
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro 4e-05
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 9e-05
cd11731198 cd11731, Lin1944_like_SDR_c, Lin1944 and related p 1e-04
cd08290341 cd08290, ETR, 2-enoyl thioester reductase (ETR) 1e-04
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 3e-04
cd08252336 cd08252, AL_MDR, Arginate lyase and other MDR fami 4e-04
cd08296333 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases 5e-04
cd08255277 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochloro 7e-04
TIGR01829242 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reducta 7e-04
cd08285351 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd 9e-04
cd05280325 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putativ 0.002
cd08284344 cd08284, FDH_like_2, Glutathione-dependent formald 0.002
cd05344253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 0.002
cd05283337 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA 0.003
PRK06198260 PRK06198, PRK06198, short chain dehydrogenase; Pro 0.003
PRK07791286 PRK07791, PRK07791, short chain dehydrogenase; Pro 0.004
>gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase Back     alignment and domain information
 Score =  366 bits (943), Expect = e-117
 Identities = 127/300 (42%), Positives = 178/300 (59%), Gaps = 23/300 (7%)

Query: 462 QIYYSSINFRDIMLTTAKLAPEVIESRRLYQHCVIGFEYSGRLR---------DSGKRVM 512
           ++  + +NFRD+++       E           V+G E +G +            G RVM
Sbjct: 2   EVRAAGLNFRDVLIALGLYPGEA----------VLGGECAGVVTRVGPGVTGLAVGDRVM 51

Query: 513 GLTSGRSLANCCETDVEMAWEIPDQWTLEDAATVPCVYATAVYAMFICGQMQKGESILIH 572
           GL  G + A    TD  +   IPD W+ E+AATVP V+ TA YA+    +++ GES+LIH
Sbjct: 52  GLAPG-AFATRVVTDARLVVPIPDGWSFEEAATVPVVFLTAYYALVDLARLRPGESVLIH 110

Query: 573 AGSGGVGQAAINLARYMDAEIFTTVGTPEKREFIRKTFPFIKEENIGNSRDTSFEQLVMK 632
           A +GGVGQAAI LAR++ AE+F T G+PEKR+F+R     I +++I +SRD SF   +++
Sbjct: 111 AAAGGVGQAAIQLARHLGAEVFATAGSPEKRDFLR--ALGIPDDHIFSSRDLSFADEILR 168

Query: 633 RTKGRGVDLVLNSLAEEKLQASVRCLAQGGRFLEIGKFDLANNNMLGMEVFMRETSFHGV 692
            T GRGVD+VLNSL+ E L AS+RCLA GGRF+EIGK D+ +N+ L M  F    S+H V
Sbjct: 169 ATGGRGVDVVLNSLSGEFLDASLRCLAPGGRFVEIGKRDIRDNSQLAMAPFRPNVSYHAV 228

Query: 693 MLDNFFFAEQEWKMSLQKALQKAIDAGAVQPLVRTIFPEDKVEEAFRYMAAGKHIGKVII 752
            LD       +    L   + +    G ++PL  T+FP    E+AFRYM  GKHIGKV++
Sbjct: 229 DLD-ALEEGPDRIRELLAEVLELFAEGVLRPLPVTVFPISDAEDAFRYMQQGKHIGKVVL 287


Enoylreductase in Polyketide synthases. Length = 287

>gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase Back     alignment and domain information
>gnl|CDD|187657 cd08954, KR_1_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of fatty acid synthase (FAS), subgroup 1, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|214833 smart00822, PKS_KR, This enzymatic domain is part of bacterial polyketide synthases Back     alignment and domain information
>gnl|CDD|187582 cd05274, KR_FAS_SDR_x, ketoreductase (KR) and fatty acid synthase (FAS), complex (x) SDRs Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|219957 pfam08659, KR, KR domain Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176213 cd08251, polyketide_synthase, polyketide synthase Back     alignment and domain information
>gnl|CDD|187658 cd08955, KR_2_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of fatty acid synthase (FAS), subgroup 2, complex (x) Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|187655 cd08952, KR_1_SDR_x, ketoreductase (KR), subgroup 1, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|187659 cd08956, KR_3_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of fatty acid synthase (FAS), subgroup 3, complex (x) Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members Back     alignment and domain information
>gnl|CDD|222256 pfam13602, ADH_zinc_N_2, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase Back     alignment and domain information
>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases Back     alignment and domain information
>gnl|CDD|216224 pfam00975, Thioesterase, Thioesterase domain Back     alignment and domain information
>gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like Back     alignment and domain information
>gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|225041 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|176190 cd05288, PGDH, Prostaglandin dehydrogenases Back     alignment and domain information
>gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase Back     alignment and domain information
>gnl|CDD|176231 cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|188164 TIGR01751, crot-CoA-red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|187657 cd08954, KR_1_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of fatty acid synthase (FAS), subgroup 1, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|214834 smart00823, PKS_PP, Phosphopantetheine attachment site Back     alignment and domain information
>gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|225856 COG3319, COG3319, Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|182701 PRK10754, PRK10754, quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|234022 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR) Back     alignment and domain information
>gnl|CDD|215989 pfam00550, PP-binding, Phosphopantetheine attachment site Back     alignment and domain information
>gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|212497 cd11731, Lin1944_like_SDR_c, Lin1944 and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members Back     alignment and domain information
>gnl|CDD|176256 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>gnl|CDD|188169 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase Back     alignment and domain information
>gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236099 PRK07791, PRK07791, short chain dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1392
KOG1202|consensus2376 100.0
KOG1197|consensus336 100.0
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 100.0
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 100.0
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 100.0
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 100.0
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 100.0
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 100.0
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 100.0
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 100.0
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 100.0
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 100.0
KOG0023|consensus360 100.0
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 100.0
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 100.0
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 100.0
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 100.0
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 100.0
PLN02827378 Alcohol dehydrogenase-like 100.0
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 100.0
PLN02586360 probable cinnamyl alcohol dehydrogenase 100.0
PLN02740381 Alcohol dehydrogenase-like 100.0
KOG0024|consensus354 100.0
KOG1198|consensus347 100.0
PLN02178375 cinnamyl-alcohol dehydrogenase 100.0
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 100.0
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 100.0
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 100.0
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 99.98
PRK09880343 L-idonate 5-dehydrogenase; Provisional 99.98
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 99.98
PLN02514357 cinnamyl-alcohol dehydrogenase 99.98
PTZ00354334 alcohol dehydrogenase; Provisional 99.97
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 99.97
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 99.97
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 99.97
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 99.97
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 99.97
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 99.97
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 99.97
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 99.97
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 99.97
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 99.97
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 99.97
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 99.97
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 99.97
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 99.97
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 99.97
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 99.97
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 99.97
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 99.97
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 99.97
COG3208244 GrsT Predicted thioesterase involved in non-riboso 99.97
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 99.97
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 99.97
cd08251303 polyketide_synthase polyketide synthase. Polyketid 99.97
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 99.97
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 99.97
KOG0022|consensus375 99.97
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 99.97
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 99.97
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 99.97
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 99.96
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 99.96
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 99.96
COG2130340 Putative NADP-dependent oxidoreductases [General f 99.96
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 99.96
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 99.96
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 99.96
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 99.96
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 99.96
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 99.96
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 99.96
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 99.96
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 99.96
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 99.96
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 99.96
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 99.96
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 99.96
PRK10083339 putative oxidoreductase; Provisional 99.96
cd08252336 AL_MDR Arginate lyase and other MDR family members 99.96
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 99.96
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 99.96
PRK13771334 putative alcohol dehydrogenase; Provisional 99.96
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 99.96
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 99.96
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 99.96
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 99.96
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 99.96
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 99.96
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 99.96
cd08275337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 99.96
KOG0025|consensus354 99.96
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 99.96
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 99.96
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 99.96
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 99.96
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 99.95
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 99.95
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 99.95
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 99.95
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 99.95
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 99.95
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 99.95
cd08247352 AST1_like AST1 is a cytoplasmic protein associated 99.95
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 99.95
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 99.95
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 99.95
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 99.95
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 99.95
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 99.95
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 99.95
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 99.95
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 99.95
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 99.94
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 99.94
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 99.94
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 99.94
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 99.94
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 99.94
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 99.94
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 99.94
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 99.94
PLN02702364 L-idonate 5-dehydrogenase 99.94
PRK06484520 short chain dehydrogenase; Validated 99.93
COG3319257 Thioesterase domains of type I polyketide synthase 99.93
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 99.92
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.92
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 99.91
PRK102521296 entF enterobactin synthase subunit F; Provisional 99.91
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.9
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 99.9
KOG1200|consensus256 99.9
KOG1196|consensus343 99.88
TIGR028132582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.88
KOG1205|consensus282 99.88
KOG1201|consensus300 99.88
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 99.88
COG0300265 DltE Short-chain dehydrogenases of various substra 99.87
PRK07791286 short chain dehydrogenase; Provisional 99.85
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.85
PRK05876275 short chain dehydrogenase; Provisional 99.84
PRK06139330 short chain dehydrogenase; Provisional 99.84
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.84
PRK05872296 short chain dehydrogenase; Provisional 99.84
PRK06114254 short chain dehydrogenase; Provisional 99.84
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.84
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.83
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.83
PRK08339263 short chain dehydrogenase; Provisional 99.83
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.83
PRK07985294 oxidoreductase; Provisional 99.83
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.83
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.82
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.82
PRK07063260 short chain dehydrogenase; Provisional 99.82
PRK06128300 oxidoreductase; Provisional 99.82
PRK07478254 short chain dehydrogenase; Provisional 99.82
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.82
PRK07062265 short chain dehydrogenase; Provisional 99.82
PRK08589272 short chain dehydrogenase; Validated 99.82
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.81
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.81
PRK07677252 short chain dehydrogenase; Provisional 99.81
PRK12937245 short chain dehydrogenase; Provisional 99.81
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.81
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.81
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.81
PRK08643256 acetoin reductase; Validated 99.81
PRK07109334 short chain dehydrogenase; Provisional 99.81
PRK05855582 short chain dehydrogenase; Validated 99.81
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.81
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.81
PRK08265261 short chain dehydrogenase; Provisional 99.8
PRK06180277 short chain dehydrogenase; Provisional 99.8
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.8
PRK07814263 short chain dehydrogenase; Provisional 99.8
PRK07576264 short chain dehydrogenase; Provisional 99.8
PRK05867253 short chain dehydrogenase; Provisional 99.8
PRK12747252 short chain dehydrogenase; Provisional 99.8
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.8
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.8
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.8
PRK06398258 aldose dehydrogenase; Validated 99.8
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.8
PRK07825273 short chain dehydrogenase; Provisional 99.8
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.8
PRK06500249 short chain dehydrogenase; Provisional 99.8
PRK06701290 short chain dehydrogenase; Provisional 99.8
KOG0725|consensus270 99.8
PRK07890258 short chain dehydrogenase; Provisional 99.79
PRK08936261 glucose-1-dehydrogenase; Provisional 99.79
PRK05599246 hypothetical protein; Provisional 99.79
PRK07024257 short chain dehydrogenase; Provisional 99.79
PRK06194287 hypothetical protein; Provisional 99.79
PLN02253280 xanthoxin dehydrogenase 99.79
PRK06138252 short chain dehydrogenase; Provisional 99.79
PRK09242257 tropinone reductase; Provisional 99.79
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.79
PRK08303305 short chain dehydrogenase; Provisional 99.79
PRK06172253 short chain dehydrogenase; Provisional 99.79
PRK08226263 short chain dehydrogenase; Provisional 99.79
PRK08628258 short chain dehydrogenase; Provisional 99.79
PRK12744257 short chain dehydrogenase; Provisional 99.79
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.79
PRK12743256 oxidoreductase; Provisional 99.79
PRK05717255 oxidoreductase; Validated 99.78
PRK07454241 short chain dehydrogenase; Provisional 99.78
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.78
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.78
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.78
PRK08267260 short chain dehydrogenase; Provisional 99.78
PRK12746254 short chain dehydrogenase; Provisional 99.78
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.78
PRK08862227 short chain dehydrogenase; Provisional 99.78
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.78
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.78
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.78
PRK06483236 dihydromonapterin reductase; Provisional 99.78
PRK08251248 short chain dehydrogenase; Provisional 99.78
PRK07067257 sorbitol dehydrogenase; Provisional 99.78
PRK06123248 short chain dehydrogenase; Provisional 99.78
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.78
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.78
PRK07775274 short chain dehydrogenase; Provisional 99.78
PRK07832272 short chain dehydrogenase; Provisional 99.77
PRK07035252 short chain dehydrogenase; Provisional 99.77
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.77
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.77
PRK07856252 short chain dehydrogenase; Provisional 99.77
PRK05650270 short chain dehydrogenase; Provisional 99.77
PRK09134258 short chain dehydrogenase; Provisional 99.77
PRK07831262 short chain dehydrogenase; Provisional 99.77
PRK08277278 D-mannonate oxidoreductase; Provisional 99.77
PRK06198260 short chain dehydrogenase; Provisional 99.77
PRK09072263 short chain dehydrogenase; Provisional 99.77
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.77
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.77
PRK05866293 short chain dehydrogenase; Provisional 99.77
PRK08263275 short chain dehydrogenase; Provisional 99.77
PRK08278273 short chain dehydrogenase; Provisional 99.77
PRK06125259 short chain dehydrogenase; Provisional 99.76
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.76
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.76
PRK06841255 short chain dehydrogenase; Provisional 99.76
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.76
PRK06482276 short chain dehydrogenase; Provisional 99.76
PRK12827249 short chain dehydrogenase; Provisional 99.76
PRK06181263 short chain dehydrogenase; Provisional 99.76
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.76
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.76
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.76
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.76
PRK12939250 short chain dehydrogenase; Provisional 99.76
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.75
PRK05993277 short chain dehydrogenase; Provisional 99.75
PRK06179270 short chain dehydrogenase; Provisional 99.75
PRK08340259 glucose-1-dehydrogenase; Provisional 99.75
PRK05693274 short chain dehydrogenase; Provisional 99.75
PRK05854313 short chain dehydrogenase; Provisional 99.75
PRK06101240 short chain dehydrogenase; Provisional 99.75
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.75
PRK06914280 short chain dehydrogenase; Provisional 99.75
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.75
PLN02780320 ketoreductase/ oxidoreductase 99.75
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.75
PRK10538248 malonic semialdehyde reductase; Provisional 99.75
PRK06947248 glucose-1-dehydrogenase; Provisional 99.74
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.74
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.74
PRK07774250 short chain dehydrogenase; Provisional 99.74
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.74
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.74
PRK07578199 short chain dehydrogenase; Provisional 99.74
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.74
PRK06182273 short chain dehydrogenase; Validated 99.74
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.74
PRK08324681 short chain dehydrogenase; Validated 99.74
PRK06940275 short chain dehydrogenase; Provisional 99.73
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.73
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 99.73
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.73
PRK06949258 short chain dehydrogenase; Provisional 99.73
PRK06523260 short chain dehydrogenase; Provisional 99.73
PRK07904253 short chain dehydrogenase; Provisional 99.73
PRK07069251 short chain dehydrogenase; Validated 99.73
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.73
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.73
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.72
PRK05875276 short chain dehydrogenase; Provisional 99.72
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.72
PRK08703239 short chain dehydrogenase; Provisional 99.72
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.72
PRK06484520 short chain dehydrogenase; Validated 99.71
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.71
PRK07102243 short chain dehydrogenase; Provisional 99.71
KOG4169|consensus261 99.71
PRK07326237 short chain dehydrogenase; Provisional 99.71
PRK09291257 short chain dehydrogenase; Provisional 99.71
PRK06057255 short chain dehydrogenase; Provisional 99.71
PRK12829264 short chain dehydrogenase; Provisional 99.7
PRK12828239 short chain dehydrogenase; Provisional 99.7
PRK09186256 flagellin modification protein A; Provisional 99.7
PRK08264238 short chain dehydrogenase; Validated 99.7
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.7
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.7
PRK07023243 short chain dehydrogenase; Provisional 99.7
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.7
PRK07201657 short chain dehydrogenase; Provisional 99.7
PRK07041230 short chain dehydrogenase; Provisional 99.7
PLN00015308 protochlorophyllide reductase 99.69
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.69
KOG1207|consensus245 99.68
PRK07577234 short chain dehydrogenase; Provisional 99.68
PRK09135249 pteridine reductase; Provisional 99.68
KOG1210|consensus331 99.68
PRK06924251 short chain dehydrogenase; Provisional 99.68
COG1028251 FabG Dehydrogenases with different specificities ( 99.67
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.67
PRK12742237 oxidoreductase; Provisional 99.67
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.67
PRK06197306 short chain dehydrogenase; Provisional 99.67
PRK124673956 peptide synthase; Provisional 99.67
PRK07074257 short chain dehydrogenase; Provisional 99.67
PRK06196315 oxidoreductase; Provisional 99.66
PRK08017256 oxidoreductase; Provisional 99.66
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 99.66
KOG1199|consensus260 99.65
PRK05884223 short chain dehydrogenase; Provisional 99.65
KOG1610|consensus322 99.64
PRK08177225 short chain dehydrogenase; Provisional 99.63
PRK06953222 short chain dehydrogenase; Provisional 99.63
PRK07060245 short chain dehydrogenase; Provisional 99.62
KOG1208|consensus314 99.62
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.61
PRK07806248 short chain dehydrogenase; Provisional 99.6
KOG1014|consensus312 99.6
KOG1209|consensus289 99.59
PRK08219227 short chain dehydrogenase; Provisional 99.57
PRK12367245 short chain dehydrogenase; Provisional 99.56
PRK09009235 C factor cell-cell signaling protein; Provisional 99.56
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 99.5
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.49
KOG1611|consensus249 99.45
PRK06720169 hypothetical protein; Provisional 99.37
PF14765295 PS-DH: Polyketide synthase dehydratase; PDB: 3KG7_ 99.36
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.35
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.33
COG0623259 FabI Enoyl-[acyl-carrier-protein] 99.32
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.31
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 99.31
KOG1204|consensus253 99.24
PLN02572442 UDP-sulfoquinovose synthase 99.23
PLN02214342 cinnamoyl-CoA reductase 99.22
PF13602127 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ 99.22
PLN02896353 cinnamyl-alcohol dehydrogenase 99.21
PLN02583297 cinnamoyl-CoA reductase 99.2
PLN03209576 translocon at the inner envelope of chloroplast su 99.2
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.18
PLN02653340 GDP-mannose 4,6-dehydratase 99.17
PLN02240352 UDP-glucose 4-epimerase 99.17
PLN00198338 anthocyanidin reductase; Provisional 99.16
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.14
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.14
PLN02650351 dihydroflavonol-4-reductase 99.11
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.1
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.07
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.06
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.04
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.03
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.02
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.01
PRK10673255 acyl-CoA esterase; Provisional 99.0
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 98.99
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 98.95
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 98.93
KOG1502|consensus327 98.92
PLN02686367 cinnamoyl-CoA reductase 98.92
KOG1478|consensus341 98.91
TIGR01746367 Thioester-redct thioester reductase domain. It has 98.9
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 98.88
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 98.84
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 98.83
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 98.8
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 98.79
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 98.79
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 98.78
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 98.78
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 98.77
PF0055067 PP-binding: Phosphopantetheine attachment site; In 98.76
PLN02578354 hydrolase 98.76
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 98.75
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 98.74
PLN02427386 UDP-apiose/xylose synthase 98.72
PLN02211273 methyl indole-3-acetate methyltransferase 98.71
PLN02824294 hydrolase, alpha/beta fold family protein 98.71
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 98.7
PRK10349256 carboxylesterase BioH; Provisional 98.69
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 98.65
PLN02695370 GDP-D-mannose-3',5'-epimerase 98.65
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 98.65
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 98.64
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 98.63
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 98.62
PLN02679360 hydrolase, alpha/beta fold family protein 98.62
PLN02996491 fatty acyl-CoA reductase 98.62
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 98.61
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 98.6
PRK03592295 haloalkane dehalogenase; Provisional 98.59
PLN02894402 hydrolase, alpha/beta fold family protein 98.56
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 98.56
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 98.52
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 98.52
PRK00870302 haloalkane dehalogenase; Provisional 98.51
PLN02260668 probable rhamnose biosynthetic enzyme 98.51
CHL00194317 ycf39 Ycf39; Provisional 98.48
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 98.48
TIGR03611257 RutD pyrimidine utilization protein D. This protei 98.47
PRK05855 582 short chain dehydrogenase; Validated 98.46
PLN02965255 Probable pheophorbidase 98.43
PRK08775343 homoserine O-acetyltransferase; Provisional 98.42
KOG1371|consensus343 98.41
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 98.4
PRK11908347 NAD-dependent epimerase/dehydratase family protein 98.39
PHA02857276 monoglyceride lipase; Provisional 98.39
PRK06489360 hypothetical protein; Provisional 98.38
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 98.38
PLN02206442 UDP-glucuronate decarboxylase 98.36
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 98.34
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 98.34
PRK03204286 haloalkane dehalogenase; Provisional 98.33
PRK07201657 short chain dehydrogenase; Provisional 98.32
PLN02385349 hydrolase; alpha/beta fold family protein 98.31
PRK05865 854 hypothetical protein; Provisional 98.31
PLN03084383 alpha/beta hydrolase fold protein; Provisional 98.3
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 98.26
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 98.25
KOG1430|consensus361 98.24
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 98.24
KOG1454|consensus326 98.22
PLN02503605 fatty acyl-CoA reductase 2 98.21
COG3320382 Putative dehydrogenase domain of multifunctional n 98.18
PLN02166436 dTDP-glucose 4,6-dehydratase 98.18
KOG2382|consensus315 98.15
PRK08309177 short chain dehydrogenase; Provisional 98.11
PRK0098278 acpP acyl carrier protein; Provisional 98.1
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 98.06
PRK00175379 metX homoserine O-acetyltransferase; Provisional 98.05
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.03
PLN02298330 hydrolase, alpha/beta fold family protein 98.01
KOG4409|consensus365 97.99
PLN02778298 3,5-epimerase/4-reductase 97.97
PLN02652395 hydrolase; alpha/beta fold family protein 97.96
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 97.94
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 97.94
PRK07581339 hypothetical protein; Validated 97.93
PRK10749330 lysophospholipase L2; Provisional 97.9
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 97.9
PRK11071190 esterase YqiA; Provisional 97.87
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 97.83
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 97.82
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 97.8
CHL0012482 acpP acyl carrier protein; Validated 97.8
PRK06060705 acyl-CoA synthetase; Validated 97.77
smart00826167 PKS_DH PKS_DH. 97.76
PRK0588391 acyl carrier protein; Validated 97.76
smart0082386 PKS_PP Phosphopantetheine attachment site. Phospho 97.75
PRK0708183 acyl carrier protein; Provisional 97.69
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 97.68
PRK0918489 acyl carrier protein; Provisional 97.67
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 97.67
TIGR0051777 acyl_carrier acyl carrier protein. S (Ser) at posi 97.67
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.64
PRK0535082 acyl carrier protein; Provisional 97.61
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 97.58
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 97.57
KOG4022|consensus236 97.55
PRK1244980 acyl carrier protein; Provisional 97.53
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 97.52
KOG1221|consensus467 97.52
PLN02511388 hydrolase 97.52
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 97.51
PLN02260668 probable rhamnose biosynthetic enzyme 97.51
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.5
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 97.48
PRK0711779 acyl carrier protein; Validated 97.47
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 97.42
PRK0582884 acyl carrier protein; Validated 97.39
PRK0763986 acyl carrier protein; Provisional 97.38
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 97.37
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 97.37
PF08643299 DUF1776: Fungal family of unknown function (DUF177 97.35
PRK12320 699 hypothetical protein; Provisional 97.35
PLN00016378 RNA-binding protein; Provisional 97.32
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 97.31
PRK05077414 frsA fermentation/respiration switch protein; Revi 97.29
PRK0817282 putative acyl carrier protein IacP; Validated 97.27
PRK13604307 luxD acyl transferase; Provisional 97.27
COG023680 AcpP Acyl carrier protein [Lipid metabolism / Seco 97.23
>KOG1202|consensus Back     alignment and domain information
Probab=100.00  E-value=1.6e-253  Score=2208.28  Aligned_cols=1301  Identities=45%  Similarity=0.765  Sum_probs=1191.7

Q ss_pred             eeeeccCCCCceeEeeccccCCCCcccccccchh-hHH----HHHHHHHHHHHHHcCCCCccCCEEeeeeeeeeeeeeCC
Q psy1119          24 TLLKEAPRKGLVQLKNSFRSLSASPKRLASTALD-RVY----QRFQMAWETVSLMRGELYTEVPVVFENIKFMRATNVPK   98 (1392)
Q Consensus        24 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~gh~id-r~l----~yl~l~W~t~a~~~~~~~~~~pv~fe~v~~~rat~l~~   98 (1392)
                      .+.++ +.||...|+||.+  .+++.||+||.|| |||    |||+|+|+|||+++|.+|+++||+||||.|||||||+|
T Consensus       855 ~f~~g-s~s~~a~~niD~~--~edd~yL~~HtiDGRvLfPaTGymtlaW~tlak~qGldy~ktPVvfEdvv~h~ATIL~k  931 (2376)
T KOG1202|consen  855 KFPGG-SGSSAAIYNIDLS--KEDDHYLADHTIDGRVLFPATGYMTLAWKTLAKPQGLDYEKTPVVFEDVVFHRATILPK  931 (2376)
T ss_pred             ccCCC-CCccceEEEccCC--ccccceeccceecceEEeccccchhHHHHHHhhhccCCcccCceeeeeeeeeeeEeecC
Confidence            34445 5569999999999  7775599999999 999    99999999999999999999999999999999999999


Q ss_pred             CCeEEEEEEEEeccccEEEeeCCcEEEEEEEEccCCcccccccCCCCCCCCCCCcccccCChhhHHHHHHhcCCccCccc
Q psy1119          99 EGSVEFIVMVQKGSGNFEIVEGGAAIVTGKVYIPADVKTEMVRIPDQYKIPRTEGEAIELQSRDIYKELRLRGYHYKGLF  178 (1392)
Q Consensus        99 ~~~v~~~v~i~~~sg~Fei~~~~~~vvsG~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~diYkel~lrGy~y~~~F  178 (1392)
                      ++.|+|.|++++|||.|||||+++++||||||++++++++++++++.+    .....++|.++|+|||||||||+|+|.|
T Consensus       932 ~~vvkl~v~~~~gs~aFEi~e~~~l~~SGki~i~ed~~~~~~~l~e~~----~~~~a~eL~t~dvYKElrLRGYdYg~~F 1007 (2376)
T KOG1202|consen  932 TGVVKLEVNLFPGSGAFEICENGSLVVSGKIYIPEDPDPELLDLEESP----TSAPAEELATADVYKELRLRGYDYGGHF 1007 (2376)
T ss_pred             CceEEEEEEEcCCCcceEEecCCcEEEeeeEeccCCCchhhcccccCC----CcchhhhhhHHHHHHHHHhcccccchhh
Confidence            999999999999999999999999999999999999999988887744    3344448999999999999999999999


Q ss_pred             cceeeeccCCceeEEEecccchhhhhhhhheeccccCCCceecccceeeEEEcchhhHhhhhccCCCCCeeeEEEecccC
Q psy1119         179 RSLNVADGAGTQGKIRWHNNWVAFMDNMLQLQILQYDTRGLFVPTSIQKLVINVSDHVNLLSTLDEETPEYPVFVYKEVE  258 (1392)
Q Consensus       179 ~~i~~~~~~g~~g~i~W~~nWv~f~d~mlQ~~il~~~~~~l~~Pt~i~~~~i~p~~h~~~~~~~~~~~~~~~v~~~~~~~  258 (1392)
                      |||.++++.|..|+++|.+|||+|||+||||+||+.+.|+|||||||+++.|||.+|.+++.+++ +++++.|++++   
T Consensus      1008 qGI~~s~~s~~tG~L~W~dNWvsFmDtmLQ~siLs~~~~~LylPTrv~~~~IdP~kH~e~~~~~~-~~~qve~rw~~--- 1083 (2376)
T KOG1202|consen 1008 QGILESDLSGDTGRLQWKDNWVSFMDTMLQFSILSSAKRELYLPTRVERAHIDPAKHLELLYTLQ-DKAQVEVRWLR--- 1083 (2376)
T ss_pred             hhhhhhccccccceEEEeccHHHHHHHHHHHHHHhhcccceecccceeeeeeChHHHHHHHHhhc-chheEEeeeee---
Confidence            99999999999999999999999999999999999999999999999999999999999999885 56678999998   


Q ss_pred             cEEeccEEEeceeeeccCCCCCCCC-CeeeeEEeeeCc----------------------------cccc--C-------
Q psy1119         259 VIKSGGVEIRGLKASAIPRKKPLGE-PVLEKYKFIQNE----------------------------GLKV--K-------  300 (1392)
Q Consensus       259 ~~~~ggvei~gl~~~~~~rr~~~~~-p~le~~~Fvp~~----------------------------~~~~--~-------  300 (1392)
                      +++||||||+|||+..++||++.|. |.||||+||||.                            ..|+  |       
T Consensus      1084 v~~agGVei~~l~t~s~~RR~~~q~~p~lEk~~F~Ph~~~~~lse~qe~~~~k~L~~aiQ~ii~~s~~k~~~~gv~la~~ 1163 (2376)
T KOG1202|consen 1084 VTKAGGVEISGLKTESAQRRQQEQQPPILEKYCFVPHTEHGCLSEQQEKQLLKALVVAIQTIIENSGLKVKLKGVELAQI 1163 (2376)
T ss_pred             eEEeccEEecccchhhhhccccccCCCceeeEEeeccccccccchHHHHHHHHHHHHHHHHHhhhccceeeecceeccCc
Confidence            9999999999999999999999886 999999999997                            1111  1       


Q ss_pred             --------------------------------------------------------------------------------
Q psy1119         301 --------------------------------------------------------------------------------  300 (1392)
Q Consensus       301 --------------------------------------------------------------------------------  300 (1392)
                                                                                                      
T Consensus      1164 ~~~~~~lsa~~~lqlie~dpll~GD~av~ns~~~~~t~~~vl~~~gi~~t~~dl~~~~~E~~~h~v~~~d~l~~d~~~~l 1243 (2376)
T KOG1202|consen 1164 RRLPDLLSAACLLQLIEEDPLLSGDTAVENSPSNEMTVVEVLAGHGIRYTAKDLEAAQVEQQCHFVAQADLLVCDPAKAL 1243 (2376)
T ss_pred             cCcHHHHHHHHHHhhcccCcccccceeEeeCCcchHhHHHHHhcCCcEEEEeccchhHHHHhhhhhhccCeEecChHHHH
Confidence                                                                                            


Q ss_pred             ----------------------------------------------------CCCCCCCeEeecChhccccHHHHHHHHh
Q psy1119         301 ----------------------------------------------------SPVKISPLVIKVSGVDFHWIPILQKALA  328 (1392)
Q Consensus       301 ----------------------------------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~  328 (1392)
                                                                          ..+.++|++..+++++|+|++.||..+.
T Consensus      1244 e~~~~slre~GFLll~e~~~~~~~~G~~~l~e~~lv~~~es~~g~~l~l~Rr~s~~~s~~~~~~~~k~F~Wve~Lk~~la 1323 (2376)
T KOG1202|consen 1244 ENCVASLREGGFLLLEELLSTYPQYGQAILSEFRLVGVKESFYGSTLVLVRRPSPQDSPIFLVVDDKSFNWVESLKGILA 1323 (2376)
T ss_pred             HHHHHHHhcCCeEEEEhhccCCcchhHHHhhheeeEEeecccCCceEEEEecCCCCCCceEEeccccceehHHHHHHHHh
Confidence                                                                1234679999999999999999999887


Q ss_pred             hcccCCCceEEEEcCCCCchhHhHHHHHHhhhcCCCceEEEEEcCCCCCCCCCChhHHHHHhhcCceEEEEecCccccee
Q psy1119         329 AEETSTKQKIILLSQLEPLSGIIGFFNCIRKETGGERTRCFEILDKNAPPFNPEDPFYKVQVEKDLAVNILRNGQWGTYR  408 (1392)
Q Consensus       329 ~~~~~~~~~lw~~~~~~~~~~~~Gl~r~lr~E~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~r~g~~~~~~  408 (1392)
                      +..  ..+.+||++++++.+|++||++|+++|+++ ..|++++.|.+.|.|++.+.+|+.|+.+|++.||||||.||+||
T Consensus      1324 ~~~--~ek~v~lva~~~~~~G~vGL~~Clk~E~gg-~~R~~~~~d~s~p~~~l~~~~~~k~le~DLv~NvyrdGaWGs~R 1400 (2376)
T KOG1202|consen 1324 DAD--SEKPVWLVAQGCANSGAVGLMNCLKRENGG-TLRLVLLSDLSVPEFSLGSAEYQKQLEKDLVMNVYRDGAWGSFR 1400 (2376)
T ss_pred             hhh--ccCcEEEEecCCcccCcchHhhHhhhcCCC-eEEEEEeecCCCCcccCCCHHHHHHHHhhhhhhhhhcCccccee
Confidence            764  248999999999999999999999999998 69999999988999999999999999999999999999999999


Q ss_pred             ecccC-cccccccCceeEeeccCCCCCCceEEeCCCCcccccccCCCCCCeEEEEEEEEecChhhHHHhcCCCChhhhhh
Q psy1119         409 HSILQ-PIKRVMTDHAYINALVRGDMSSLTWEQGPVNMKTWKKYSKDNINHDIAQIYYSSINFRDIMLTTAKLAPEVIES  487 (1392)
Q Consensus       409 ~~~~~-~~~~~~~~~~~l~~~~~G~l~~l~~~~~~~~~~~~~~~~~~~~~evlV~V~a~gln~~Dv~~~~G~~~~~~~~~  487 (1392)
                      |+.+. +....+.+|+|++..++||+++|+|++.|.....+     ..++.-+|.|+|++|||||+|+++|+++++++||
T Consensus      1401 Hl~le~~~~~~~~ehAfvntLtrGDlsSlrWies~~~~a~~-----~~~~~e~CtVYYAplNFRDiMLasGkL~~DAiPG 1475 (2376)
T KOG1202|consen 1401 HLKLEEDKPELPVEHAFVNTLTRGDLSSLRWIESPLRHAQP-----TCPGLELCTVYYAPLNFRDIMLASGKLSPDAIPG 1475 (2376)
T ss_pred             eeEecccCCCcchHHHHHHHhhhccccceeeeecchhhcCC-----CCCCCceeEEEeccccHHHHHHhcCCCCcccCCC
Confidence            99988 44566899999999999999999999999864221     4678899999999999999999999999999999


Q ss_pred             hccccccccceeeEEEEeeCCCeEEEeecCCcccceEEecccceEEcCCCCCHhhHhhhhHHHHHHHHHHHHhcCCCCCC
Q psy1119         488 RRLYQHCVIGFEYSGRLRDSGKRVMGLTSGRSLANCCETDVEMAWEIPDQWTLEDAATVPCVYATAVYAMFICGQMQKGE  567 (1392)
Q Consensus       488 ~~~~~p~~lG~E~sGvV~~vGdrV~gl~~~g~~a~~v~~~~~~~~~iPd~ls~e~AA~lp~~~~TA~~aL~~~a~l~~Ge  567 (1392)
                      ....++|+||+||+|+.. .|.||||+.+..++|+.|.++.+++|.+|.+|++|||+++||+|+||||||+.++++++||
T Consensus      1476 ~~a~qdclLGmEFsGRd~-~GrRvM~mvpAksLATt~l~~rd~lWevP~~WTleeAstVP~VYsTaYYALVvRG~mkkGe 1554 (2376)
T KOG1202|consen 1476 DLASQDCLLGMEFSGRDA-SGRRVMGMVPAKSLATTVLASRDFLWEVPSKWTLEEASTVPVVYSTAYYALVVRGQMKKGE 1554 (2376)
T ss_pred             ccchhhheeceeeccccC-CCcEEEEeeehhhhhhhhhcchhhhhhCCcccchhhcccCceEeeeehhhhhhhccccCCc
Confidence            999999999999999998 9999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEcCCchHHHHHHHHHHHcCCEEEEEecChhhHHHHHHHCCCCCcCceeeCCCccHHHHHHHHcCCCcceEEEecCc
Q psy1119         568 SILIHAGSGGVGQAAINLARYMDAEIFTTVGTPEKREFIRKTFPFIKEENIGNSRDTSFEQLVMKRTKGRGVDLVLNSLA  647 (1392)
Q Consensus       568 tVLI~ga~GgVG~aaIqlA~~~Ga~V~~tv~s~ek~~~l~~~~p~l~~~~i~~s~~~~~~~~i~~~T~g~GvDvVlds~~  647 (1392)
                      +||||+|+||||||||.+|.+.||+||+||+|.|||+||+++||++...++.||||++|++.|+..|+|+|||+|+|+++
T Consensus      1555 kiLIHaGsGGVGQAAIaiALa~G~~VFTTVGSaEKRefL~~rFPqLqe~~~~NSRdtsFEq~vl~~T~GrGVdlVLNSLa 1634 (2376)
T KOG1202|consen 1555 KILIHAGSGGVGQAAIAIALAHGCTVFTTVGSAEKREFLLKRFPQLQETNFANSRDTSFEQHVLWHTKGRGVDLVLNSLA 1634 (2376)
T ss_pred             EEEEecCCCchhHHHHHHHHHcCCEEEEecCcHHHHHHHHHhchhhhhhcccccccccHHHHHHHHhcCCCeeeehhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHhcccCCeEEEEEcccccccCccccccccCCCcEEEEEechhhhhhCHHHHHHHHHHHHHHHHcCCCCCccee
Q psy1119         648 EEKLQASVRCLAQGGRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEWKMSLQKALQKAIDAGAVQPLVRT  727 (1392)
Q Consensus       648 ~~~l~~s~~~La~~Gr~v~iG~~~~~~~~~l~~~~~~k~~s~~g~~~~~~~~~~~~~~~~~~~~~~~~l~~g~l~pl~~~  727 (1392)
                      .|.+++++|||+.+|||++||++|++.+++++|..|.||+||||+.+++++....+.+.+...++.+.+++|.++|++++
T Consensus      1635 eEkLQASiRCLa~~GRFLEIGKfDLSqNspLGMavfLkNvsfHGiLLDsvmege~e~~~ev~~Lv~eGIksGvV~PL~tt 1714 (2376)
T KOG1202|consen 1635 EEKLQASIRCLALHGRFLEIGKFDLSQNSPLGMAVFLKNVSFHGILLDSVMEGEEEMWREVAALVAEGIKSGVVRPLPTT 1714 (2376)
T ss_pred             HHHHHHHHHHHHhcCeeeeecceecccCCcchhhhhhcccceeeeehhhhhcCcHHHHHHHHHHHHhhhccCceeccccc
Confidence            99999999999999999999999999999999999999999999999999998888999999999999999999999999


Q ss_pred             eeccccHHHHHHHHHcCCccceEEEEecCCCCccccCCcc-cccccCCccccCCCCeEEEEcCcchHHHHHHHHHHHhCC
Q psy1119         728 IFPEDKVEEAFRYMAAGKHIGKVIIKIRDEEPTKICTPKV-KQLLAVPRYYADSNKSYIICGGLGGFGLELADWLVLRGA  806 (1392)
Q Consensus       728 vf~l~ev~eA~~~l~~g~~~GKvVI~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~ylItGG~gGiG~~lA~~La~~GA  806 (1392)
                      +|+-.++++|||+|++|||+||||++++.++.. ....|. +.+.++|+.+|+|.++|+|+||+||+|+++|+||+.|||
T Consensus      1715 vF~~~qvE~AFRfMasGKHIGKVvikvr~eE~~-k~~~pk~r~i~AI~rt~~hpeksYii~GGLGGFGLELaqWLi~RGa 1793 (2376)
T KOG1202|consen 1715 VFHGQQVEDAFRFMASGKHIGKVVIKVRAEEPA-KAKGPKPRLISAIPRTYCHPEKSYIIVGGLGGFGLELAQWLIQRGA 1793 (2376)
T ss_pred             cccHHHHHHHHHHHhccCccceEEEEEcccccc-cccCCchhhHhhcchhhcCccceEEEeccccchhHHHHHHHHhcCc
Confidence            999999999999999999999999999887765 333343 456789999999999999999999999999999999999


Q ss_pred             ceEEEecCCCcccHHHHHHHHHHhcCCceEEEEeccCCCHHHHHHHHHHHhhcCCccEEEECcccCCCccccCCCHHHHH
Q psy1119         807 RKLVLTSRSGVKNGYQALRIKIWKSYDVQVLISTDDITTEAGVVNLLTEANKLGPVDGIFNLAVVLKDALFENQTPEDFN  886 (1392)
Q Consensus       807 r~lvl~sRs~~~~~~~~~~~~~l~~~G~~v~~~~~Dv~~~~~v~~l~~~~~~~g~I~gvi~~Agv~~d~~~~~~t~e~~~  886 (1392)
                      |++|++||||.++.++..+++.|+++|++|.+.+.||++.++.+.+++++.+++||+||||.|+|++|+.|+|++++.|+
T Consensus      1794 r~lVLtSRsGirtGYQa~~vrrWr~~GVqV~vsT~nitt~~ga~~Li~~s~kl~~vGGiFnLA~VLRD~LiEnQt~knFk 1873 (2376)
T KOG1202|consen 1794 RKLVLTSRSGIRTGYQALMVRRWRRRGVQVQVSTSNITTAEGARGLIEESNKLGPVGGIFNLAAVLRDGLIENQTPKNFK 1873 (2376)
T ss_pred             eEEEEeccccchhhHHHHHHHHHHhcCeEEEEecccchhhhhHHHHHHHhhhcccccchhhHHHHHHhhhhcccChhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhHhHHHHHHHHHHhhhCCCCCeEEEecccccccCCCCChhHHHHHHHHHHHHHHHHHcCCCeEEEEccccCccccc
Q psy1119         887 ASLGPKANATKYFDKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERICEARRAEGLPGLAVEWGAVGEVGLV  966 (1392)
Q Consensus       887 ~~~~~kv~g~~~L~~~~~~~~~~l~~fV~~SS~s~~~G~~gq~~Yaaana~ld~la~~r~~~Glp~~ai~~g~~~~~G~~  966 (1392)
                      ++-+||+.||.||+++++..|+.+++||+|||++|.+||.||+||+.||++|+++|+.||.+|+|+++|+||++||+|+.
T Consensus      1874 ~va~pK~~~Ti~LD~~sRe~C~~LdyFv~FSSvscGRGN~GQtNYG~aNS~MERiceqRr~~GfPG~AiQWGAIGDvGli 1953 (2376)
T KOG1202|consen 1874 DVAKPKYSGTINLDRVSREICPELDYFVVFSSVSCGRGNAGQTNYGLANSAMERICEQRRHEGFPGTAIQWGAIGDVGLI 1953 (2376)
T ss_pred             hhhccceeeeeehhhhhhhhCcccceEEEEEeecccCCCCcccccchhhHHHHHHHHHhhhcCCCcceeeeecccceeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchhhhhHHHHHcCccccchhhhHHHHHHHHccCCCeEEehhhhhhhc-CCCCcchHHHHHHHHhCCCCCcccCcCcchh
Q psy1119         967 ADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEPIVASMVVAEKKA-GSGGATNIVDAVINILGLRDLKTVSLHSTLA 1045 (1392)
Q Consensus       967 ~~~~~~~~~~~~~g~~~~~~~~~l~~l~~~l~~~~~~~~~~~~~~~~~-~~~~~~~l~~~~a~~l~~~~~~~i~~~~~l~ 1045 (1392)
                      -++++.+ +...+|++||++.+||+.+|.||++++|++++|++++++. +..+...|.+.+|+|||+.|...++.+.+|+
T Consensus      1954 lEnmgdN-dTvvgGTLPQRM~SCLetlDlFL~qpHpvvsS~v~AEk~~~d~~~~~dLiatiA~IlGlrD~~~vn~~asLa 2032 (2376)
T KOG1202|consen 1954 LENMGDN-DTVVGGTLPQRMPSCLETLDLFLQQPHPVVSSFVVAEKRKADQDSGRDLIATIAHILGLRDLKAVNDDASLA 2032 (2376)
T ss_pred             eeecCCC-CceeccccchhHHHHHHHHHHHhcCCchHHHHHHHHHhhcccccccccHHHHHHHHhcchhHhhccCCCchh
Confidence            9988776 6788999999999999999999999999999999999864 3455678999999999999999999999999


Q ss_pred             hcCcchhhHHHHHHHHHHHhCCccChhhhccCCHHHHHHHHhcccCCCC-CCCccccccCCcccccccCCCChhhHHHHH
Q psy1119        1046 ELGMDSMMAVEIKQTLEREFEVFLTPQDIRGLTFAKLQDIAVSFENDDK-SKPVSTEASGGQVTALSVEDIPDVGIQYLM 1124 (1392)
Q Consensus      1046 ~lG~DSL~avel~~~l~~~~~~~l~~~~i~~~ti~~La~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1124 (1392)
                      |||+||||.+|+++.|+|+|++.|++++|+.+|+.+|.++..+...... ..+.+.+.           .......+..+
T Consensus      2033 DLGlDSLMsvEikQtLER~~dlVLS~qEiRqLT~~kLqql~~~a~~~~~aa~~~~ke~-----------~~~~~qtql~~ 2101 (2376)
T KOG1202|consen 2033 DLGLDSLMSVEIKQTLEREFDLVLSAQEIRQLTLRKLQQLDSKADEAPEAACPTPKED-----------GLAQQQTQLVF 2101 (2376)
T ss_pred             hccchhhhhHHHHHHHhhhhceeeeHHHHHHHHHHHHHHhhccCCCCccccCCCCchh-----------hHHHHHHHHHH
Confidence            9999999999999999999999999999999999999988654332211 11211111           01111223333


Q ss_pred             HhhccccccCCccc--ccCCccCCCCccccCCCCCceeEeecCCCccccccHHHHhhcCCceEEEecCCCCCCCCHHHHH
Q psy1119        1125 RTIGDEILANKPVI--RLPSLKNNGSTVEEPVGNNNTIFMVPGIEGIATVLEPLAKNINAQVLVFQFDHTNPPDTIPEMA 1202 (1392)
Q Consensus      1125 ~~~~~~~~~~~~~~--~l~~~~~~~~~~~~~~g~~~pLF~vp~agG~~~~y~~La~~L~~~~~v~~l~~e~~~~sieelA 1202 (1392)
                      ..+.   .+++-.+  ++++..+          ..+|+|++||++|.+..+.+||++|..|.|++|++...|.+|||.+|
T Consensus      2102 ~~~~---v~~e~~~~l~~ka~~s----------e~~~~Ffv~pIEG~tt~l~~la~rle~PaYglQ~T~~vP~dSies~A 2168 (2376)
T KOG1202|consen 2102 RSLL---VNPEGPVLLRLKAVQS----------EEPPLFFVHPIEGFTTALESLASRLEIPAYGLQCTEAVPLDSIESLA 2168 (2376)
T ss_pred             hhhc---CCccccHHHhhhhhcc----------cCCceEEEeccccchHHHHHHHhhcCCcchhhhccccCCcchHHHHH
Confidence            2221   2333223  3333222          34899999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhhccCCCCcEEEEeechhHHHHHHHHHHHHHcCCccEEEEEeCCCCCC------------------------
Q psy1119        1203 DSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLEQLGTKCHLYLVDSAPDYV------------------------ 1258 (1392)
Q Consensus      1203 ~~y~~~I~~~q~qp~gPy~L~G~S~Gg~VA~EmA~~Le~~G~~v~LvLiD~~p~~~------------------------ 1258 (1392)
                      ++|+++||.  +||.|||+|+|||||+++|||||.+||++..+..|+|+|++|.+.                        
T Consensus      2169 ~~yirqirk--vQP~GPYrl~GYSyG~~l~f~ma~~Lqe~~~~~~lillDGspty~~~Y~~~yr~~~~~g~~~~~es~~l 2246 (2376)
T KOG1202|consen 2169 AYYIRQIRK--VQPEGPYRLAGYSYGACLAFEMASQLQEQQSPAPLILLDGSPTYVLAYTQSYRAKLTDGCENEAESEAL 2246 (2376)
T ss_pred             HHHHHHHHh--cCCCCCeeeeccchhHHHHHHHHHHHHhhcCCCcEEEecCchHHHHHHHHHHHHHcCCCcCchhHHHHH
Confidence            999999995  669999999999999999999999999999888999999999653                        


Q ss_pred             ---------------ccccCCCCChHHHHHHHHhcCCccccCCHHHHHHHHHHHHHHHHhhccccCCCCCcccceEEEEe
Q psy1119        1259 ---------------LTSLRKLPDWNAKLNYFLDLMPEDATHSRTYQRNLAHAAYKRITSILKYTDPKHKAFGGNITLLR 1323 (1392)
Q Consensus      1259 ---------------~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~y~~~~~~~~~~pi~l~~ 1323 (1392)
                                     ...+...+.|+++++.+.+.+......+++.+++.+..|+.++.++++|+|..  ++.++|+|++
T Consensus      2247 ~~f~~~~advdy~~~~~~Ll~~~~~~~rv~k~vd~~~~~~~q~~eti~~aa~~f~~Kl~lae~Ykp~~--k~~~~v~Lir 2324 (2376)
T KOG1202|consen 2247 CYFGQQFADVDYNRLLELLLPLPGWEERVAKAVDLIIKSHQQDRETIKFAARSFYYKLLLAEQYKPKA--KLHGNVTLIR 2324 (2376)
T ss_pred             HHHHHHHhcccHHHHHHHHhcCCChHHHHHHHHHHHHhhccCCHHHHHHHHHHHHHHHHhhhccCchh--hcCCcEEEEE
Confidence                           33455678999999999999887777899999999999999999999999986  8999999999


Q ss_pred             eCCCCCCChhhcCcccccCCCeEEEEEccCccccccChHHHHHHHhhhccc
Q psy1119        1324 PTEQALPTAEDYGLSKVCKKPVKVHFVDGNHFTVLDNIKSAQIIMHEDSTD 1374 (1392)
Q Consensus      1324 a~~~~~~~~~~~~W~~~~~g~v~v~~v~G~H~~ml~~~~~~~i~~~l~~~L 1374 (1392)
                      +++......+||+.+++|++++++|.++|||.++++......+..+++..+
T Consensus      2325 a~~~~A~l~eDY~l~evc~~~vevh~veGdHrTfle~ssl~tie~ilr~~~ 2375 (2376)
T KOG1202|consen 2325 AKTGGAYLGEDYGLKEVCDGKVEVHVVEGDHRTFLEGSSLETIESILRSSL 2375 (2376)
T ss_pred             ecCCCceeccccChhhhccCceeEEEEecccccccCCcchHHHHHHHHhhc
Confidence            998876688999999999999999999999999997777777776666654



>KOG1197|consensus Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG0025|consensus Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>KOG1196|consensus Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PF14765 PS-DH: Polyketide synthase dehydratase; PDB: 3KG7_D 3KG9_A 3KG8_B 3HRR_A 3HRQ_A 3EL6_A 3KG6_B 2VZ8_A 2VZ9_A Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PF00550 PP-binding: Phosphopantetheine attachment site; InterPro: IPR006163 Phosphopantetheine (or pantetheine 4' phosphate) is the prosthetic group of acyl carrier proteins (ACP) in some multienzyme complexes where it serves as a 'swinging arm' for the attachment of activated fatty acid and amino-acid groups [] Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>KOG1454|consensus Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG2382|consensus Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00982 acpP acyl carrier protein; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG4409|consensus Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>CHL00124 acpP acyl carrier protein; Validated Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>smart00826 PKS_DH PKS_DH Back     alignment and domain information
>PRK05883 acyl carrier protein; Validated Back     alignment and domain information
>smart00823 PKS_PP Phosphopantetheine attachment site Back     alignment and domain information
>PRK07081 acyl carrier protein; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09184 acyl carrier protein; Provisional Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>TIGR00517 acyl_carrier acyl carrier protein Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK05350 acyl carrier protein; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>KOG4022|consensus Back     alignment and domain information
>PRK12449 acyl carrier protein; Provisional Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>KOG1221|consensus Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07117 acyl carrier protein; Validated Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PRK05828 acyl carrier protein; Validated Back     alignment and domain information
>PRK07639 acyl carrier protein; Provisional Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PRK08172 putative acyl carrier protein IacP; Validated Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>COG0236 AcpP Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1392
2vz8_A2512 Crystal Structure Of Mammalian Fatty Acid Synthase 0.0
3slk_A795 Structure Of Ketoreductase And Enoylreductase Didom 6e-55
1pqw_A198 Putative Enoyl Reductase Domain Of Polyketide Synth 1e-30
2oby_A338 Crystal Structure Of Human P53 Inducible Oxidoreduc 8e-22
2j8z_A354 Crystal Structure Of Human P53 Inducible Oxidoreduc 9e-22
1yb5_A351 Crystal Structure Of Human Zeta-crystallin With Bou 8e-18
4dup_A353 Crystal Structure Of A Quinone Oxidoreductase From 6e-17
1wly_A333 Crystal Structure Of 2-haloacrylate Reductase Lengt 7e-16
4a27_A349 Crystal Structure Of Human Synaptic Vesicle Membran 2e-14
2cg5_B91 Structure Of Aminoadipate-Semialdehyde Dehydrogenas 4e-13
2png_A89 Type I Rat Fatty Acid Synthase Acyl Carrier Protein 4e-12
2fr0_A486 The First Ketoreductase Of The Erythromycin Synthas 2e-11
3mjc_A496 Structure Of A-Type Ketoreductases From Modular Pol 4e-11
3mjv_A496 Structure Of A-Type Ketoreductases From Modular Pol 6e-11
4dif_A496 Structure Of A1-type Ketoreductase Length = 496 6e-11
2eih_A343 Crystal Structure Of Nad-Dependent Alcohol Dehydrog 1e-10
3mjt_A496 Structure Of A-Type Ketoreductases From Modular Pol 1e-10
4eye_A342 Crystal Structure Of A Probable Oxidoreductase From 4e-10
2z5l_A511 The First Ketoreductase Of The Tylosin Pks Length = 1e-09
1xkt_A289 Human Fatty Acid Synthase: Structure And Substrate 3e-09
3tjm_A283 Crystal Structure Of The Human Fatty Acid Synthase 3e-09
2px6_A316 Crystal Structure Of The Thioesterase Domain Of Hum 4e-09
2wek_A341 Crystal Structure Of The Human Mgc45594 Gene Produc 9e-09
2c0c_A362 Structure Of The Mgc45594 Gene Product Length = 362 1e-08
2x7h_A370 Crystal Structure Of The Human Mgc45594 Gene Produc 1e-08
4di7_A556 Structure Of A2-type Ketoreductase Of Modular Polyk 1e-08
2vn8_A375 Crystal Structure Of Human Reticulon 4 Interacting 3e-07
3uog_A363 Crystal Structure Of Putative Alcohol Dehydrogenase 1e-06
3krt_A456 Crystal Structure Of Putative Crotonyl Coa Reductas 1e-06
4a0s_A447 Structure Of The 2-Octenoyl-Coa Carboxylase Reducta 2e-06
3hhd_A965 Structure Of The Human Fatty Acid Synthase Ks-Mat D 3e-06
1rjw_A339 Crystal Structure Of Nad(+)-Dependent Alcohol Dehyd 6e-06
3pii_A339 Crystal Structure Of Mutant Of Ht- Alcohol Dehydrog 9e-06
2j3h_A345 Crystal Structure Of Arabidopsis Thaliana Double Bo 1e-05
1qor_A327 Crystal Structure Of Escherichia Coli Quinone Oxido 1e-05
3hzz_A467 2.4 Angstrom Crystal Structure Of Streptomyces Coll 2e-05
3jyl_A325 Crystal Structures Of Pseudomonas Syringae Pv. Toma 5e-05
1iyz_A302 Crystal Structures Of The Quinone Oxidoreductase Fr 5e-05
3tqh_A321 Structure Of The Quinone Oxidoreductase From Coxiel 5e-05
3gaz_A343 Crystal Structure Of An Alcohol Dehydrogenase Super 7e-05
4hfj_A351 X-ray Crystal Structure Of A Double Bond Reductase 1e-04
4b7c_A336 Crystal Structure Of Hypothetical Protein Pa1648 Fr 2e-04
3qwa_A334 Crystal Structure Of Saccharomyces Cerevisiae Zeta- 2e-04
3cos_A381 Crystal Structure Of Human Class Ii Alcohol Dehydro 2e-04
1zsv_A349 Crystal Structure Of Human Nadp-Dependent Leukotrie 4e-04
2y05_A328 Crystal Structure Of Human Leukotriene B4 12-Hydrox 4e-04
2hcy_A347 Yeast Alcohol Dehydrogenase I, Saccharomyces Cerevi 8e-04
2cf2_D295 Architecture Of Mammalian Fatty Acid Synthase Lengt 8e-04
>pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase Length = 2512 Back     alignment and structure

Iteration: 1

Score = 788 bits (2036), Expect = 0.0, Method: Compositional matrix adjust. Identities = 465/1128 (41%), Positives = 664/1128 (58%), Gaps = 104/1128 (9%) Query: 306 SPLVIKVSGVDFHWIPILQKALAAEETSTKQKIILLSQLEPLSGIIGFFNCIRKETGGER 365 SP+ + V F W+ L+ LA ++ + + L++ SG++G NC+RKE GG R Sbjct: 1412 SPVFLSVEDTSFRWVDSLKDILA---DASSRPVWLMAVGCSTSGVVGMVNCLRKEPGGHR 1468 Query: 366 TRCFEILDKN----APPFNPEDPFYKVQVEKDLAVNILRNGQWGTYRHSILQ---PIKRV 418 RC + + + AP +P + ++ DL +N+ R+G WG +RH L+ P K+ Sbjct: 1469 IRCVLVSNLSSTSPAPEMHPSSSELQKVLQGDLVMNVYRDGAWGAFRHFPLEQDRPEKQ- 1527 Query: 419 MTDHAYINALVRGDMSSLTWEQGPVNMKTWKKYSKDNINHD-IAQIYYSSINFRDIMLTT 477 T+HA++N L RGD+SS+ W P++ Y+ D + +YY+S+NFRD+ML T Sbjct: 1528 -TEHAFVNVLSRGDLSSIRWVCSPLH------YALPASCQDRLCSVYYTSLNFRDVMLAT 1580 Query: 478 AKLAPEVIESRRLYQHCVIGFEYSGRLRDSGKRVMGLTSGRSLANCCETDVEMAWEIPDQ 537 KL+P+ I + L + C++G E+SGR SG+RVMG+ LA WE+P Sbjct: 1581 GKLSPDSIPGKWLTRDCMLGMEFSGR-DASGRRVMGMVPAEGLATSVLLLQHATWEVPST 1639 Query: 538 WTLEDAATVPCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMDAEIFTTV 597 WTLE+AA+VP VY TA Y++ + G+MQ GES+LIH+GSGGVGQAAI +A +FTTV Sbjct: 1640 WTLEEAASVPIVYTTAYYSLVVRGRMQPGESVLIHSGSGGVGQAAIAIALSRGCRVFTTV 1699 Query: 598 GTPEKREFIRKTFPFIKEENIGNSRDTSFEQLVMKRTKGRGVDLVLNSLAEEKLQASVRC 657 G+ EKR +++ FP + E NSRDTSFEQ V++ T G+GVDLVLNSLAEEKLQASVRC Sbjct: 1700 GSAEKRAYLQARFPQLDETCFANSRDTSFEQHVLRHTAGKGVDLVLNSLAEEKLQASVRC 1759 Query: 658 LAQGGRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEWKMSLQKALQKAID 717 LAQ GRFLEIGKFDL+NN+ LGM VF++ +FHG++LD+ F + + L+ I Sbjct: 1760 LAQHGRFLEIGKFDLSNNHALGMAVFLKNVTFHGILLDSLFEEGGATWQEVSELLKAGIQ 1819 Query: 718 AGAVQPLVRTIFPEDKVEEAFRYMAAGKHIGKVIIKIRDEE--PTKICTPKVKQLLAVPR 775 G VQPL T+FP KVE AFRYMA GKHIGKV+I++R+EE P P + L + + Sbjct: 1820 EGVVQPLKCTVFPRTKVEAAFRYMAQGKHIGKVVIQVREEEQGPAPRGLPPIA-LTGLSK 1878 Query: 776 YYADSNKSYIICGGLGGFGLELADWLVLRGARKLVLTSRSGVKNGYQALRIKIWKSYDVQ 835 + +KSY+I GGLGGFGL+LA WL LRGA+KLVLTSRSG++ GYQA +++ W+ VQ Sbjct: 1879 TFCPPHKSYVITGGLGGFGLQLAQWLRLRGAQKLVLTSRSGIRTGYQARQVREWRRQGVQ 1938 Query: 836 VLISTDDITTEAGVVNLLTEANKLGPVDGIFNLAVVLKDALFENQTPEDFNASLGPKANA 895 VL+ST + ++ G +L+TEA +LGPV G+FNLA+VL+DA+ ENQTPE F PK + Sbjct: 1939 VLVSTSNASSLDGARSLITEATQLGPVGGVFNLAMVLRDAVLENQTPEFFQDVSKPKYSG 1998 Query: 896 TKYFDKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERICEARRAEGLPGLAV 955 T D+ +R CP L FV+FSSVSCGRGNAGQ NYG ANS MERICE RR +GLPGLAV Sbjct: 1999 TANLDRVTREACPELDYFVIFSSVSCGRGNAGQANYGFANSAMERICEKRRHDGLPGLAV 2058 Query: 956 EWGAVGEVGLVADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEPIVASMVVAEKKAG 1015 +WGA+G+VG+V + N + VIGGTL QRI++CLE L+ FL Q P+++S V+AEKKA Sbjct: 2059 QWGAIGDVGVVLETMGTN-DTVIGGTLPQRIASCLEVLDLFLSQPHPVLSSFVLAEKKAA 2117 Query: 1016 S----GGATNIVDAVINILGLRDLKTVSLHSTLAELGMDSMMAVEIKQTLEREFEVFLTP 1071 + ++V AV +ILG+RD+ +++ STL +LG+DS+M VE++Q LERE ++ L+ Sbjct: 2118 APRDGSSQKDLVKAVAHILGIRDVASINPDSTLVDLGLDSLMGVEVRQILEREHDLVLSM 2177 Query: 1072 QDIRGLTFAKLQDIAVSFEND-DKSKPVSTEASGGQVTALSVEDIPDVGIQYLMRTIGDE 1130 +++R L+ KLQ+++ D D + P S E S + A T+ Sbjct: 2178 REVRQLSLRKLQELSSKTSTDADPATPTSHEDSPVRQQA----------------TLNLS 2221 Query: 1131 ILANKPVIRLPSLKNNGSTVEEPVGNNNTIFMVPGIEGIATVLEPLAKNINAQVLVFQFD 1190 L P + N+ + E P +F+V IEG TV LA ++ Q Sbjct: 2222 TLLVNPEGPTLTRLNSVQSAERP------LFLVHPIEGSITVFHGLAAKLSIPTYGLQCT 2275 Query: 1191 HTNPPDTIPEMADSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKL--EQLGTKCH- 1247 P D+I +A + ++ V ++ G+S+G VA E+ +L +Q T + Sbjct: 2276 GAAPLDSIQSLASYYIECIRQ--VQPEGPYRIAGYSYGACVAFEMCSQLQAQQSATPGNH 2333 Query: 1248 -LYLVDSAPDYVLTSLRKL---------PDWNAKLNYFL--------------DLMPEDA 1283 L+L D + +VL + + + AK YF L+P Sbjct: 2334 SLFLFDGSHTFVLAYTQSVRAKMTPGCEAEAEAKAMYFFVQQFTDMEQGKVLEALIPLQG 2393 Query: 1284 --------------THSRTYQRNLAHAA---YKRITSILKYTDPKHKAFGGNITLLRPTE 1326 +H+ + L+ AA Y+++ + Y + GN+TLLR Sbjct: 2394 LEARVAATVDLITQSHAGLDRHALSFAARSFYQKLRAAENYW--PQATYHGNVTLLRAKT 2451 Query: 1327 QAL---PTAEDYGLSKVCKKPVKVHFVDGNHFTVLD--NIKSAQIIMH 1369 DY LS+VC V VH ++G+H T+L+ ++S I+H Sbjct: 2452 GGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESILSIIH 2499
>pdb|3SLK|A Chain A, Structure Of Ketoreductase And Enoylreductase Didomain From Modular Polyketide Synthase Length = 795 Back     alignment and structure
>pdb|1PQW|A Chain A, Putative Enoyl Reductase Domain Of Polyketide Synthase Length = 198 Back     alignment and structure
>pdb|2OBY|A Chain A, Crystal Structure Of Human P53 Inducible Oxidoreductase (Tp53i3,Pig3) Length = 338 Back     alignment and structure
>pdb|2J8Z|A Chain A, Crystal Structure Of Human P53 Inducible Oxidoreductase ( Tp53i3,Pig3) Length = 354 Back     alignment and structure
>pdb|1YB5|A Chain A, Crystal Structure Of Human Zeta-crystallin With Bound Nadp Length = 351 Back     alignment and structure
>pdb|4DUP|A Chain A, Crystal Structure Of A Quinone Oxidoreductase From Rhizobium Etli Cfn 42 Length = 353 Back     alignment and structure
>pdb|1WLY|A Chain A, Crystal Structure Of 2-haloacrylate Reductase Length = 333 Back     alignment and structure
>pdb|4A27|A Chain A, Crystal Structure Of Human Synaptic Vesicle Membrane Protein Vat-1 Homolog-Like Protein Length = 349 Back     alignment and structure
>pdb|2CG5|B Chain B, Structure Of Aminoadipate-Semialdehyde Dehydrogenase- Phosphopantetheinyl Transferase In Complex With Cytosolic Acyl Carrier Protein And Coenzyme A Length = 91 Back     alignment and structure
>pdb|2PNG|A Chain A, Type I Rat Fatty Acid Synthase Acyl Carrier Protein (Acp) Domain Length = 89 Back     alignment and structure
>pdb|2FR0|A Chain A, The First Ketoreductase Of The Erythromycin Synthase (Crystal Form 1) Length = 486 Back     alignment and structure
>pdb|3MJC|A Chain A, Structure Of A-Type Ketoreductases From Modular Polyketide Synthase Length = 496 Back     alignment and structure
>pdb|3MJV|A Chain A, Structure Of A-Type Ketoreductases From Modular Polyketide Synthase Length = 496 Back     alignment and structure
>pdb|4DIF|A Chain A, Structure Of A1-type Ketoreductase Length = 496 Back     alignment and structure
>pdb|2EIH|A Chain A, Crystal Structure Of Nad-Dependent Alcohol Dehydrogenase Length = 343 Back     alignment and structure
>pdb|3MJT|A Chain A, Structure Of A-Type Ketoreductases From Modular Polyketide Synthase Length = 496 Back     alignment and structure
>pdb|4EYE|A Chain A, Crystal Structure Of A Probable Oxidoreductase From Mycobacterium Abscessus Solved By Iodide Ion Sad Length = 342 Back     alignment and structure
>pdb|2Z5L|A Chain A, The First Ketoreductase Of The Tylosin Pks Length = 511 Back     alignment and structure
>pdb|1XKT|A Chain A, Human Fatty Acid Synthase: Structure And Substrate Selectivity Of The Thioesterase Domain Length = 289 Back     alignment and structure
>pdb|3TJM|A Chain A, Crystal Structure Of The Human Fatty Acid Synthase Thioesterase Domain With An Activate Site-Specific Polyunsaturated Fatty Acyl Adduct Length = 283 Back     alignment and structure
>pdb|2PX6|A Chain A, Crystal Structure Of The Thioesterase Domain Of Human Fatty Acid Synthase Inhibited By Orlistat Length = 316 Back     alignment and structure
>pdb|2WEK|A Chain A, Crystal Structure Of The Human Mgc45594 Gene Product In Complex With Diclofenac Length = 341 Back     alignment and structure
>pdb|2C0C|A Chain A, Structure Of The Mgc45594 Gene Product Length = 362 Back     alignment and structure
>pdb|2X7H|A Chain A, Crystal Structure Of The Human Mgc45594 Gene Product In Complex With Fenoprofen Length = 370 Back     alignment and structure
>pdb|4DI7|A Chain A, Structure Of A2-type Ketoreductase Of Modular Polyketide Synthases Length = 556 Back     alignment and structure
>pdb|2VN8|A Chain A, Crystal Structure Of Human Reticulon 4 Interacting Protein 1 In Complex With Nadph Length = 375 Back     alignment and structure
>pdb|3UOG|A Chain A, Crystal Structure Of Putative Alcohol Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 363 Back     alignment and structure
>pdb|3KRT|A Chain A, Crystal Structure Of Putative Crotonyl Coa Reductase From Streptomyces Coelicolor A3(2) Length = 456 Back     alignment and structure
>pdb|4A0S|A Chain A, Structure Of The 2-Octenoyl-Coa Carboxylase Reductase Cinf In Complex With Nadp And 2-Octenoyl-Coa Length = 447 Back     alignment and structure
>pdb|3HHD|A Chain A, Structure Of The Human Fatty Acid Synthase Ks-Mat Didomain As A Framework For Inhibitor Design. Length = 965 Back     alignment and structure
>pdb|1RJW|A Chain A, Crystal Structure Of Nad(+)-Dependent Alcohol Dehydrogenase From Bacillus Stearothermophilus Strain Lld-R Length = 339 Back     alignment and structure
>pdb|3PII|A Chain A, Crystal Structure Of Mutant Of Ht- Alcohol Dehydrogenase With Substrate Analogue Butyramide Length = 339 Back     alignment and structure
>pdb|2J3H|A Chain A, Crystal Structure Of Arabidopsis Thaliana Double Bond Reductase (At5g16970)-Apo Form Length = 345 Back     alignment and structure
>pdb|1QOR|A Chain A, Crystal Structure Of Escherichia Coli Quinone Oxidoreductase Complexed With Nadph Length = 327 Back     alignment and structure
>pdb|3HZZ|A Chain A, 2.4 Angstrom Crystal Structure Of Streptomyces Collinus Crotonyl Coa CarboxylaseREDUCTASE Length = 467 Back     alignment and structure
>pdb|3JYL|A Chain A, Crystal Structures Of Pseudomonas Syringae Pv. Tomato Dc3000 Quinone Oxidoreductase Length = 325 Back     alignment and structure
>pdb|1IYZ|A Chain A, Crystal Structures Of The Quinone Oxidoreductase From Thermus Thermophilus Hb8 And Its Complex With Nadph Length = 302 Back     alignment and structure
>pdb|3TQH|A Chain A, Structure Of The Quinone Oxidoreductase From Coxiella Burnetii Length = 321 Back     alignment and structure
>pdb|3GAZ|A Chain A, Crystal Structure Of An Alcohol Dehydrogenase Superfamily Protein From Novosphingobium Aromaticivorans Length = 343 Back     alignment and structure
>pdb|4HFJ|A Chain A, X-ray Crystal Structure Of A Double Bond Reductase From Nicotiana Tabacum Length = 351 Back     alignment and structure
>pdb|4B7C|A Chain A, Crystal Structure Of Hypothetical Protein Pa1648 From Pseudomonas Aeruginosa. Length = 336 Back     alignment and structure
>pdb|3QWA|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Zeta-Crystallin-Like Quinone Oxidoreductase Zta1 Length = 334 Back     alignment and structure
>pdb|3COS|A Chain A, Crystal Structure Of Human Class Ii Alcohol Dehydrogenase (Adh4) In Complex With Nad And Zn Length = 381 Back     alignment and structure
>pdb|1ZSV|A Chain A, Crystal Structure Of Human Nadp-Dependent Leukotriene B4 12- Hydroxydehydrogenase Length = 349 Back     alignment and structure
>pdb|2Y05|A Chain A, Crystal Structure Of Human Leukotriene B4 12-Hydroxydehydrogenase In Complex With Nadp And Raloxifene Length = 328 Back     alignment and structure
>pdb|2HCY|A Chain A, Yeast Alcohol Dehydrogenase I, Saccharomyces Cerevisiae Fermentative Enzyme Length = 347 Back     alignment and structure
>pdb|2CF2|D Chain D, Architecture Of Mammalian Fatty Acid Synthase Length = 295 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1392
2vz8_A2512 Fatty acid synthase; transferase, phosphopantethei 0.0
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 3e-46
3slk_A795 Polyketide synthase extender module 2; rossmann fo 0.0
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 5e-89
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 2e-53
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 2e-52
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 4e-52
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 2e-51
4eye_A342 Probable oxidoreductase; structural genomics, niai 6e-49
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 2e-48
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 4e-47
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 3e-46
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 5e-44
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 7e-44
3krt_A456 Crotonyl COA reductase; structural genomics, prote 1e-43
3gms_A340 Putative NADPH:quinone reductase; structural genom 3e-43
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 3e-41
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 3e-39
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 8e-39
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 1e-38
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 1e-37
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 1e-37
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 3e-37
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 1e-34
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 1e-34
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 1e-34
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 2e-33
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 9e-33
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 9e-32
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 2e-31
3fbg_A346 Putative arginate lyase; structural genomics, unkn 2e-30
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 4e-30
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 6e-30
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 9e-28
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 1e-27
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 5e-27
2cg5_B91 Fatty acid synthase; transferase-hydrolase complex 7e-24
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 1e-23
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 6e-21
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 1e-19
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 7e-19
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 9e-19
1kez_A300 Erythronolide synthase; polyketide synthase, modul 9e-18
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 6e-16
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 1e-15
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 1e-15
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 2e-15
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 3e-15
3tej_A329 Enterobactin synthase component F; nonribosomal pe 8e-15
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 9e-14
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 2e-13
3hhd_A965 Fatty acid synthase; transferase, multienzyme, meg 5e-13
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 2e-12
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 2e-12
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 2e-12
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 4e-12
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 1e-11
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 2e-11
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 3e-11
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 5e-11
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 8e-11
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 2e-10
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 3e-10
3qlj_A322 Short chain dehydrogenase; structural genomics, se 4e-10
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 6e-10
2vsq_A1304 Surfactin synthetase subunit 3; ligase, peptidyl c 5e-09
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 8e-09
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 8e-09
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 1e-08
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 4e-08
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 6e-08
3imf_A257 Short chain dehydrogenase; structural genomics, in 8e-08
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 1e-07
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 2e-07
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 2e-07
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 3e-07
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 4e-07
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 5e-07
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 6e-07
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 8e-07
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 1e-06
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 1e-06
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 2e-06
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 2e-06
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 2e-06
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 2e-06
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 3e-06
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 3e-06
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 3e-06
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 3e-06
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 4e-06
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 5e-06
4eso_A255 Putative oxidoreductase; NADP, structural genomics 7e-06
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 8e-06
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 9e-06
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 1e-05
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 1e-05
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 1e-05
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 1e-05
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 2e-05
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 2e-05
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 2e-05
4e4y_A244 Short chain dehydrogenase family protein; structur 3e-05
1xkq_A280 Short-chain reductase family member (5D234); parra 3e-05
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 3e-05
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 4e-05
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 4e-05
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 5e-05
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 5e-05
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 5e-05
3rih_A293 Short chain dehydrogenase or reductase; structural 5e-05
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 6e-05
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 6e-05
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 6e-05
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 7e-05
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 8e-05
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 8e-05
1spx_A278 Short-chain reductase family member (5L265); paral 8e-05
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 8e-05
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 8e-05
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 8e-05
1xhl_A297 Short-chain dehydrogenase/reductase family member 9e-05
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 1e-04
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 1e-04
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 1e-04
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 1e-04
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 1e-04
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 1e-04
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 1e-04
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 2e-04
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 2e-04
1xq1_A266 Putative tropinone reducatse; structural genomics, 2e-04
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 2e-04
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 2e-04
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 2e-04
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 2e-04
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 2e-04
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 2e-04
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 3e-04
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 3e-04
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 3e-04
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 3e-04
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 3e-04
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 3e-04
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 3e-04
3tjr_A301 Short chain dehydrogenase; structural genomics, se 3e-04
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 4e-04
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 4e-04
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 4e-04
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 4e-04
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 4e-04
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 4e-04
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 4e-04
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 4e-04
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 5e-04
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 5e-04
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 6e-04
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 6e-04
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 6e-04
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier p 6e-04
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 6e-04
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 7e-04
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 7e-04
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 7e-04
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 8e-04
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 8e-04
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 8e-04
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 8e-04
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
 Score =  939 bits (2429), Expect = 0.0
 Identities = 455/1134 (40%), Positives = 645/1134 (56%), Gaps = 92/1134 (8%)

Query: 297  LKVKSPVKISPLVIKVSGVDFHWIPILQKALAAEETSTKQKIILLSQLEPLSGIIGFFNC 356
            L  +   + SP+ + V    F W+  L+  LA   +   + + L++     SG++G  NC
Sbjct: 1403 LCRQQTPQDSPVFLSVEDTSFRWVDSLKDILADASS---RPVWLMAVGCSTSGVVGMVNC 1459

Query: 357  IRKETGGERTRCFEILDKN----APPFNPEDPFYKVQVEKDLAVNILRNGQWGTYRHSIL 412
            +RKE GG R RC  + + +    AP  +P     +  ++ DL +N+ R+G WG +RH  L
Sbjct: 1460 LRKEPGGHRIRCVLVSNLSSTSPAPEMHPSSSELQKVLQGDLVMNVYRDGAWGAFRHFPL 1519

Query: 413  -QPIKRVMTDHAYINALVRGDMSSLTWEQGPVNMKTWKKYSKDNINHDIAQIYYSSINFR 471
             Q      T+HA++N L RGD+SS+ W   P++                  +YY+S+NFR
Sbjct: 1520 EQDRPEKQTEHAFVNVLSRGDLSSIRWVCSPLHYALPASCQDRLC-----SVYYTSLNFR 1574

Query: 472  DIMLTTAKLAPEVIESRRLYQHCVIGFEYSGRLRDSGKRVMGLTSGRSLANCCETDVEMA 531
            D+ML T KL+P+ I  + L + C++G E+SGR   SG+RVMG+     LA          
Sbjct: 1575 DVMLATGKLSPDSIPGKWLTRDCMLGMEFSGRDA-SGRRVMGMVPAEGLATSVLLLQHAT 1633

Query: 532  WEIPDQWTLEDAATVPCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMDA 591
            WE+P  WTLE+AA+VP VY TA Y++ + G+MQ GES+LIH+GSGGVGQAAI +A     
Sbjct: 1634 WEVPSTWTLEEAASVPIVYTTAYYSLVVRGRMQPGESVLIHSGSGGVGQAAIAIALSRGC 1693

Query: 592  EIFTTVGTPEKREFIRKTFPFIKEENIGNSRDTSFEQLVMKRTKGRGVDLVLNSLAEEKL 651
             +FTTVG+ EKR +++  FP + E    NSRDTSFEQ V++ T G+GVDLVLNSLAEEKL
Sbjct: 1694 RVFTTVGSAEKRAYLQARFPQLDETCFANSRDTSFEQHVLRHTAGKGVDLVLNSLAEEKL 1753

Query: 652  QASVRCLAQGGRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEWKMSLQKA 711
            QASVRCLAQ GRFLEIGKFDL+NN+ LGM VF++  +FHG++LD+ F         + + 
Sbjct: 1754 QASVRCLAQHGRFLEIGKFDLSNNHALGMAVFLKNVTFHGILLDSLFEEGGATWQEVSEL 1813

Query: 712  LQKAIDAGAVQPLVRTIFPEDKVEEAFRYMAAGKHIGKVIIKIRDEEPTKICTPKVKQLL 771
            L+  I  G VQPL  T+FP  KVE AFRYMA GKHIGKV+I++R+EE            L
Sbjct: 1814 LKAGIQEGVVQPLKCTVFPRTKVEAAFRYMAQGKHIGKVVIQVREEEQGPAPRGLPPIAL 1873

Query: 772  -AVPRYYADSNKSYIICGGLGGFGLELADWLVLRGARKLVLTSRSGVKNGYQALRIKIWK 830
              + + +   +KSY+I GGLGGFGL+LA WL LRGA+KLVLTSRSG++ GYQA +++ W+
Sbjct: 1874 TGLSKTFCPPHKSYVITGGLGGFGLQLAQWLRLRGAQKLVLTSRSGIRTGYQARQVREWR 1933

Query: 831  SYDVQVLISTDDITTEAGVVNLLTEANKLGPVDGIFNLAVVLKDALFENQTPEDFNASLG 890
               VQVL+ST + ++  G  +L+TEA +LGPV G+FNLA+VL+DA+ ENQTPE F     
Sbjct: 1934 RQGVQVLVSTSNASSLDGARSLITEATQLGPVGGVFNLAMVLRDAVLENQTPEFFQDVSK 1993

Query: 891  PKANATKYFDKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERICEARRAEGL 950
            PK + T   D+ +R  CP L  FV+FSSVSCGRGNAGQ NYG ANS MERICE RR +GL
Sbjct: 1994 PKYSGTANLDRVTREACPELDYFVIFSSVSCGRGNAGQANYGFANSAMERICEKRRHDGL 2053

Query: 951  PGLAVEWGAVGEVGLVADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEPIVASMVVA 1010
            PGLAV+WGA+G+VG+V +    N + VIGGTL QRI++CLE L+ FL Q  P+++S V+A
Sbjct: 2054 PGLAVQWGAIGDVGVVLETMGTN-DTVIGGTLPQRIASCLEVLDLFLSQPHPVLSSFVLA 2112

Query: 1011 EKKAGS----GGATNIVDAVINILGLRDLKTVSLHSTLAELGMDSMMAVEIKQTLEREFE 1066
            EKKA +        ++V AV +ILG+RD+ +++  STL +LG+DS+M VE++Q LERE +
Sbjct: 2113 EKKAAAPRDGSSQKDLVKAVAHILGIRDVASINPDSTLVDLGLDSLMGVEVRQILEREHD 2172

Query: 1067 VFLTPQDIRGLTFAKLQDIAVSFENDDKSKPVSTEASGGQVTALSVEDIPDVGIQYLMRT 1126
            + L+ +++R L+  KLQ+++             T       T  S ED P      L  +
Sbjct: 2173 LVLSMREVRQLSLRKLQELS-----------SKTSTDADPATPTSHEDSPVRQQATLNLS 2221

Query: 1127 IGDEILANKPVIRLPSLKNNGSTVEEPVGNNNTIFMVPGIEGIATVLEPLAKNINAQVLV 1186
                      + RL S+     + E P+      F+V  IEG  TV   LA  ++     
Sbjct: 2222 TLLVNPEGPTLTRLNSV----QSAERPL------FLVHPIEGSITVFHGLAAKLSIPTYG 2271

Query: 1187 FQFDHTNPPDTIPEMADSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLEQLG--- 1243
             Q     P D+I  +A   +   ++  V      ++ G+S+G  VA E+  +L+      
Sbjct: 2272 LQCTGAAPLDSIQSLASYYIECIRQ--VQPEGPYRIAGYSYGACVAFEMCSQLQAQQSAT 2329

Query: 1244 -TKCHLYLVDSAPDYV---------------------------------------LTSLR 1263
                 L+L D +  +V                                       L +L 
Sbjct: 2330 PGNHSLFLFDGSHTFVLAYTQSVRAKMTPGCEAEAEAKAMYFFVQQFTDMEQGKVLEALI 2389

Query: 1264 KLPDWNAKLNYFLDLMPEDAT-HSRTYQRNLAHAAYKRITSILKYTDPKHKAFGGNITLL 1322
             L    A++   +DL+ +      R      A + Y+++ +   Y  P+   + GN+TLL
Sbjct: 2390 PLQGLEARVAATVDLITQSHAGLDRHALSFAARSFYQKLRAAENY-WPQAT-YHGNVTLL 2447

Query: 1323 RPTEQALPTA---EDYGLSKVCKKPVKVHFVDGNHFTVLDNIKSAQIIMHEDST 1373
            R             DY LS+VC   V VH ++G+H T+L+      I+    S 
Sbjct: 2448 RAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESILSIIHSC 2501


>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Length = 198 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Length = 486 Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Length = 511 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Length = 525 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Length = 496 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Length = 316 Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Length = 283 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Length = 91 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Length = 230 Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Length = 319 Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Length = 300 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Length = 244 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Length = 329 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Length = 965 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Length = 265 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Length = 267 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Length = 242 Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Length = 319 Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Length = 280 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Length = 1304 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Length = 352 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Length = 324 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Length = 398 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Length = 89 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Length = 398 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Length = 345 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Length = 330 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Length = 328 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Length = 105 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Length = 258 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Length = 255 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Length = 181 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Length = 95 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Length = 371 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Length = 88 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1392
2vz8_A2512 Fatty acid synthase; transferase, phosphopantethei 100.0
3slk_A795 Polyketide synthase extender module 2; rossmann fo 100.0
4eye_A342 Probable oxidoreductase; structural genomics, niai 100.0
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 100.0
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 100.0
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 100.0
3gms_A340 Putative NADPH:quinone reductase; structural genom 100.0
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 100.0
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 100.0
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 100.0
3fbg_A346 Putative arginate lyase; structural genomics, unkn 100.0
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 100.0
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 100.0
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 100.0
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 100.0
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 100.0
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 100.0
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 100.0
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 100.0
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 100.0
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 100.0
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 100.0
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 100.0
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 100.0
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 100.0
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 100.0
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 100.0
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 100.0
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 100.0
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 100.0
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 100.0
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 100.0
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 100.0
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 100.0
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 100.0
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 100.0
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 100.0
3krt_A456 Crotonyl COA reductase; structural genomics, prote 100.0
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 100.0
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 100.0
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 100.0
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 100.0
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 100.0
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 100.0
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 100.0
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 100.0
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 100.0
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 100.0
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 100.0
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 100.0
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 100.0
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 100.0
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 100.0
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 100.0
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 100.0
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 100.0
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 100.0
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 100.0
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 100.0
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 100.0
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 100.0
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 100.0
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 100.0
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 100.0
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 100.0
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 100.0
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 100.0
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 100.0
3tej_A329 Enterobactin synthase component F; nonribosomal pe 99.98
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.97
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.97
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 99.96
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.96
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.95
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.94
2vsq_A1304 Surfactin synthetase subunit 3; ligase, peptidyl c 99.94
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.93
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.93
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.92
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.92
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 99.91
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.9
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.9
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.9
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.9
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.89
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.89
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.89
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.89
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.89
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.89
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.89
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.89
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.89
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 99.89
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.88
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.88
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.88
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.88
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.88
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.88
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.88
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.88
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.88
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.88
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.88
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.88
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.88
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.88
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.88
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.88
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.88
3rih_A293 Short chain dehydrogenase or reductase; structural 99.88
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.88
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.88
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.88
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.88
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.88
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.88
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.88
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.88
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.88
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.87
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.87
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.87
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.87
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.87
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.87
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.87
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.87
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.87
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.87
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.87
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.87
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.87
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.87
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.87
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.87
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.87
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.87
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.87
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.87
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.87
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.87
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.86
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.86
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.86
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.86
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.86
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.86
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.86
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.86
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.86
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.86
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.86
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.86
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.86
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.86
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.86
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.86
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.86
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.86
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.86
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.86
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.86
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.86
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.86
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.86
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.86
3cxt_A291 Dehydrogenase with different specificities; rossma 99.86
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.86
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.85
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.85
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.85
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.85
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.85
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.85
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.85
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.85
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.85
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.85
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.85
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.85
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.85
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.85
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.85
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.85
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.85
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.85
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.85
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.85
1xkq_A280 Short-chain reductase family member (5D234); parra 99.85
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 99.85
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.85
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.85
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.84
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.84
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.84
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.84
1spx_A278 Short-chain reductase family member (5L265); paral 99.84
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.84
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.84
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.84
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.84
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.84
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.84
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.84
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.84
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.84
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.84
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.84
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.84
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.84
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.84
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.84
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.84
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.84
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.84
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.83
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.83
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.83
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.83
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.83
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.83
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.83
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.83
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.83
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.83
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.83
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.83
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.83
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.83
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.83
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.83
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.83
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.82
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.82
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.82
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.82
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.82
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.82
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.82
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.82
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.82
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.82
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.82
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.82
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.82
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.82
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.82
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.82
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.82
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.82
4e4y_A244 Short chain dehydrogenase family protein; structur 99.82
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.81
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.81
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.81
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.81
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.81
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.81
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.81
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.81
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.81
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.81
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.81
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.8
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.8
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.8
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.8
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.8
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.8
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.79
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.79
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.79
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.79
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.78
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.78
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 99.78
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.78
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.78
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.78
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.78
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.78
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.77
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.76
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.76
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.76
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.76
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.76
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.75
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.75
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.74
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 99.74
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.74
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.73
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 99.73
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.72
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 99.72
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.71
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.65
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.6
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.6
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.57
1kez_A300 Erythronolide synthase; polyketide synthase, modul 99.57
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.57
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.53
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.48
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.44
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.44
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.43
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.42
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.41
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.41
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.41
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.41
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.4
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.4
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.4
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.39
3kg6_A285 CURF; polyketide synthase, double hotdog fold, deh 99.39
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.39
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.38
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.37
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.36
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.36
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.35
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.35
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.35
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.35
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.34
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.34
3kg8_A308 CURJ; polyketide synthase, double hotdog fold, deh 99.33
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.33
3kg9_A296 CURK; polyketide synthase, double hotdog fold, deh 99.33
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.32
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.32
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.32
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.32
1xq6_A253 Unknown protein; structural genomics, protein stru 99.32
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.32
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.31
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.31
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.3
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.3
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.29
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.29
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.28
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.28
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.28
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.27
3el6_A313 Erythromycin dehydratase; dehydratase double hotdo 99.27
3kg7_A293 CURH; polyketide synthase, double hotdog fold, deh 99.26
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.26
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.25
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.25
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.25
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.24
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.23
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.23
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.23
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.23
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.22
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.22
2cg5_B91 Fatty acid synthase; transferase-hydrolase complex 99.21
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.2
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.2
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.19
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.18
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.18
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.17
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.17
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.17
1z45_A699 GAL10 bifunctional protein; epimerase, mutarotase, 99.16
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.16
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.14
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.13
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.1
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.1
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.1
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.09
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.08
3hrq_A357 PKS, aflatoxin biosynthesis polyketide synthase; h 99.07
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.07
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.05
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.05
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.05
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.04
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.02
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.02
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.01
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.01
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.0
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.0
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.0
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 98.99
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 98.99
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 98.99
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 98.98
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 98.97
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 98.96
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 98.95
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 98.95
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 98.95
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 98.94
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 98.94
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.94
2wm3_A299 NMRA-like family domain containing protein 1; unkn 98.92
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 98.92
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 98.92
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 98.92
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 98.91
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 98.91
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 98.9
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 98.9
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 98.89
3llc_A270 Putative hydrolase; structural genomics, joint cen 98.88
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 98.87
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 98.87
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 98.87
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 98.87
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 98.87
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 98.87
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 98.87
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 98.86
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 98.86
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 98.86
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 98.85
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 98.85
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 98.85
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 98.85
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 98.85
1iup_A282 META-cleavage product hydrolase; aromatic compound 98.85
4i4d_A93 Peptide synthetase NRPS type II-PCP; structural ge 98.83
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 98.83
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 98.83
1dny_A91 Non-ribosomal peptide synthetase peptidyl carrier 98.82
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 98.82
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 98.82
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 98.82
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 98.81
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 98.81
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 98.81
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 98.3
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 98.8
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 98.8
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 98.8
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 98.79
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 98.79
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 98.78
2ju1_A95 Erythronolide synthase; carrier protein domain, mo 98.76
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 98.76
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 98.75
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 98.75
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 98.73
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 98.73
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.71
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 98.7
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 98.7
2cq8_A110 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH 98.69
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 98.68
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 98.67
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 98.67
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 98.66
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 98.66
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 98.66
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 98.66
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 98.65
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 98.65
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 98.64
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 98.64
2liu_A99 CURA; holo state, transferase; NMR {Lyngbya majusc 98.64
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 98.63
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 98.63
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 98.63
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 98.61
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 98.61
3ius_A286 Uncharacterized conserved protein; APC63810, silic 98.6
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 98.59
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.59
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty ac 98.58
2ehs_A77 ACP, acyl carrier protein; lipid transport, struct 98.57
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 98.56
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 98.56
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 98.56
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 98.53
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 98.53
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 98.52
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis 98.51
1vkh_A273 Putative serine hydrolase; structural genomics, jo 98.5
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 98.5
3hhd_A965 Fatty acid synthase; transferase, multienzyme, meg 98.5
3h04_A275 Uncharacterized protein; protein with unknown func 98.5
1x3o_A80 Acyl carrier protein; structural genomics, riken s 98.49
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 98.49
2lol_A81 ACP, acyl carrier protein; lipid transport; NMR {R 98.48
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.48
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 98.47
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolici 98.47
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
Probab=100.00  E-value=9e-145  Score=1538.37  Aligned_cols=1305  Identities=40%  Similarity=0.693  Sum_probs=783.7

Q ss_pred             ceeEeeccccCCCC-cccccccchh-hHH----HHHHHHHHHHHHHcCCCCccCCEEeeeeeeeeeeeeCCCCeEEEEEE
Q psy1119          34 LVQLKNSFRSLSAS-PKRLASTALD-RVY----QRFQMAWETVSLMRGELYTEVPVVFENIKFMRATNVPKEGSVEFIVM  107 (1392)
Q Consensus        34 ~~~~~~~~~~~~~~-~~~l~gh~id-r~l----~yl~l~W~t~a~~~~~~~~~~pv~fe~v~~~rat~l~~~~~v~~~v~  107 (1392)
                      ...+.++++  .++ ..||.||+|+ +++    ||+.++|++++...+......|++|+|++|++++++++++.+++.+.
T Consensus       859 ~~~~~~~~~--~~~~~~wl~~H~v~g~~~~P~~~y~~~a~~a~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~  936 (2512)
T 2vz8_A          859 VAVYKFDVS--PESPDHYLVDHCIDGRVLFPGTGYLWLTWKTLARALSQNLEETPVVFEDVTLHQATILPKTGTVSLEVR  936 (2512)
T ss_dssp             EEEEEEECS--TTSGGGGGGGCEETTEEECCHHHHHHHHHHHHHHHTTCCGGGCCEEEEEEEECSCCEECSSSEEEEEEE
T ss_pred             eEEEEEEcc--cccCCchhccCeECCEEeeCcHHHHHHHHHHHHHhhccccccCCeEEEeeEEeeceeecCCCCEEEEEE
Confidence            445677776  556 4499999999 988    99999999999988887888899999999999999999999999999


Q ss_pred             EEeccccEEEee-CCcEEEEEEEEccCCcccccccCCCCCCCCCCCcccccCChhhHHHHHHhcCCccCccccceeeecc
Q psy1119         108 VQKGSGNFEIVE-GGAAIVTGKVYIPADVKTEMVRIPDQYKIPRTEGEAIELQSRDIYKELRLRGYHYKGLFRSLNVADG  186 (1392)
Q Consensus       108 i~~~sg~Fei~~-~~~~vvsG~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~diYkel~lrGy~y~~~F~~i~~~~~  186 (1392)
                      +.++++.|+|+. +++..++|+|+.........+...... .+........++.+++|++|+.+||+||+.||+|+++..
T Consensus       937 ~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~Y~~~~~~g~~yg~~F~~~~~~~~ 1015 (2512)
T 2vz8_A          937 LLEASHAFEVSDSNGSLIASGKVYQWESPDPKLFDTRAAV-DPADSTAEFRLSQGDVYKDLRLRGYDYGPFFQLVLESDL 1015 (2512)
T ss_dssp             EETTTTEEEEEETTCCEEEEEEEEECSSCCGGGGCCCCSS-CCCCCSSSCEEEHHHHHHHHHHHTCCCCGGGCCEEEEET
T ss_pred             EEcCCceEEEecCCCcEEEEEEEEecCCCCcccccccccc-ccccccccccCCHHHHHHHHHHhcCcCCchhcCeeeEEE
Confidence            999999999998 788999999987655444322211100 011112223578899999999999999999999999999


Q ss_pred             CCceeEEEecccchhhhhhhhheeccccCCCceecccceeeEEEcchhhHhhhhccCCCCCeeeEEEecccCcEEeccEE
Q psy1119         187 AGTQGKIRWHNNWVAFMDNMLQLQILQYDTRGLFVPTSIQKLVINVSDHVNLLSTLDEETPEYPVFVYKEVEVIKSGGVE  266 (1392)
Q Consensus       187 ~g~~g~i~W~~nWv~f~d~mlQ~~il~~~~~~l~~Pt~i~~~~i~p~~h~~~~~~~~~~~~~~~v~~~~~~~~~~~ggve  266 (1392)
                      ++..|++.|.++|.++||++||..++..+.+.+|||++|+++.|+|..|.........+....++.++...+.++++|++
T Consensus      1016 ~~~~~~~~~~~~~~~~lD~~lq~~~~~~~~~~~~~p~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1095 (2512)
T 2vz8_A         1016 EGNRGRLQWNDSWVSFLDAMLHMSILAPGQLGLYLPTRFTSIRIDPVTHRQKLYTLQDTTQAADVVVDRNLNTVVAGGAL 1095 (2512)
T ss_dssp             TSSEEEEEECSCHHHHHHHHHHHHHTCTTCCSCEEECBCSCCEECHHHHHHHCEECSSSCEEEEEEEETTTTEEEETTEE
T ss_pred             cCceEEEecCCccchHHHHHHHHHHHhccCCcceecceEeEEEEecCCccceeEeccCCCceeEEEEECCCCcEEeeeEE
Confidence            99999999999999999999999998888888999999999999999887655443344445788899999999999999


Q ss_pred             EeceeeeccCCCCCCC-CCeeeeEEeeeCcccc--------------------------------c--C-----------
Q psy1119         267 IRGLKASAIPRKKPLG-EPVLEKYKFIQNEGLK--------------------------------V--K-----------  300 (1392)
Q Consensus       267 i~gl~~~~~~rr~~~~-~p~le~~~Fvp~~~~~--------------------------------~--~-----------  300 (1392)
                      |.|++++.++++.... .|.++++.|.|+....                                .  +           
T Consensus      1096 ~~~~~~~~~~~~~~~~~~~~~~~~~w~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1175 (2512)
T 2vz8_A         1096 FLGAHSSVAPRRPQEHLKPILEKFCFTPHVESGCLAGNTALQEELQLCRGLAQALQTKVAQQGLKMVVPGLDGAQAPREA 1175 (2512)
T ss_dssp             EESCCEEECCCCCCTTSCCEEEECCEEESEEEEECCCCCCC---------------------------------------
T ss_pred             EeccEEeecCcccccCCCcceeeEEEEecCcccccccchhhHHHHHHHHHHHHHHHHHHHHHHHHHhHHHhhhccccccc
Confidence            9999999988876433 3666666665532000                                0  0           


Q ss_pred             ------------------------------------------------------------C-------------------
Q psy1119         301 ------------------------------------------------------------S-------------------  301 (1392)
Q Consensus       301 ------------------------------------------------------------~-------------------  301 (1392)
                                                                                  +                   
T Consensus      1176 ~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ilEigagtg~~t 1255 (2512)
T 2vz8_A         1176 PQQSLPRLLAAACQLQLNGNLQLELGQVLAQERPLLCDDPLLSGLLDAPALKACVDTALENMASPKMKVVEVLAGDGQLY 1255 (2512)
T ss_dssp             -----------------------------------------CSSCCCSSTTHHHHHHHHTTSSSSEEEEEEESCSSSCCT
T ss_pred             cccchHHHhhhhhhhhhhhHHHHHHHHHHhcccccccccchHHHHhhhhHHHHHHHHHHhcCCCCCceEEEECCCccHHH
Confidence                                                                        0                   


Q ss_pred             -----------------------------------------------CC-------------------------------
Q psy1119         302 -----------------------------------------------PV-------------------------------  303 (1392)
Q Consensus       302 -----------------------------------------------~~-------------------------------  303 (1392)
                                                                     .+                               
T Consensus      1256 ~~il~~l~~~~~~~~~yt~td~s~~~~~~a~~~f~~~di~~~~~d~~~~~~~~~~~ydlvia~~vl~~t~~~~~~l~~~~ 1335 (2512)
T 2vz8_A         1256 SRIPALLNTQPVMDLDYTATDRNPQALEAAQAKLEQLHVTQGQWDPANPAPGSLGKADLLVCNCALATLGDPAVAVGNMA 1335 (2512)
T ss_dssp             TTHHHHTTTSSSCEEEEEEECSSSSSTTTTTTTHHHHTEEEECCCSSCCCC-----CCEEEEECC---------------
T ss_pred             HHHHHhhcccCcccceEEEecCChHHHHHHHHHhhhcccccccccccccccCCCCceeEEEEcccccccccHHHHHHHHH
Confidence                                                           00                               


Q ss_pred             --------------------------------------------------------------------------CCCCeE
Q psy1119         304 --------------------------------------------------------------------------KISPLV  309 (1392)
Q Consensus       304 --------------------------------------------------------------------------~~~~~~  309 (1392)
                                                                                                .+.|++
T Consensus      1336 ~lL~p~G~l~~~e~~~~~~~g~~~~~~~~~~r~~~~~~~~~~w~~~l~~~gf~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1415 (2512)
T 2vz8_A         1336 ATLKEGGFLLLHTLLAGHPLGEMVGFLTSPEQGGRHLLSQDQWESLFAGASLHLVALKRSFYGSVLFLCRQQTPQDSPVF 1415 (2512)
T ss_dssp             -----CCEEEEEEC--------------------------CTTTTSSTTTTEEEEEEEEETTSCEEEEEEECCCCCCCEE
T ss_pred             HhcCCCcEEEEEeccccccccccccccccccccCCcccCHHHHHHHHHhCCCceeeeccCCCceEEEEEeccccCCCCEE
Confidence                                                                                      001122


Q ss_pred             eecChhccccHHHHHHHHhhcccCCCceEEEEcCCCCchhHhHHHHHHhhhcCCCceEEEEEcCC----CCCCCCCChhH
Q psy1119         310 IKVSGVDFHWIPILQKALAAEETSTKQKIILLSQLEPLSGIIGFFNCIRKETGGERTRCFEILDK----NAPPFNPEDPF  385 (1392)
Q Consensus       310 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~lw~~~~~~~~~~~~Gl~r~lr~E~~~~~~~~~~~~~~----~~~~~~~~~~~  385 (1392)
                      +.+++.+|.|++.|++.+..+.   .+.+|+++++++.++++||+||+|+|+++.+++++++++.    ..+.+...+.+
T Consensus      1416 ~~~~~~~~~~~~~l~~~~~~~~---~~~~~~~~~~~~~~~~~Gl~r~l~~E~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1492 (2512)
T 2vz8_A         1416 LSVEDTSFRWVDSLKDILADAS---SRPVWLMAVGCSTSGVVGMVNCLRKEPGGHRIRCVLVSNLSSTSPAPEMHPSSSE 1492 (2512)
T ss_dssp             EECCCTTCTHHHHHSSTTTSSC---CCCEEEEESSCTTCCHHHHHHHHTTSGGGTTSCCEEEECCCCSTTCCCCCCSSSH
T ss_pred             EEecCchHHHHHHHHHHHHhcC---CCcEEEECCCchhhhhHHHHHHHHhcCCCCCEEEEEecCCcccccccccchhhHH
Confidence            2233344555555554443321   2467999888888889999999999999888999999754    23445555678


Q ss_pred             HHHHhhcCceEEEEecCcccceeecccCccc-ccccCceeEeeccCCCCCCceEEeCCCCcccccccCCCCCCeEEEEEE
Q psy1119         386 YKVQVEKDLAVNILRNGQWGTYRHSILQPIK-RVMTDHAYINALVRGDMSSLTWEQGPVNMKTWKKYSKDNINHDIAQIY  464 (1392)
Q Consensus       386 ~~~~~~~~~~~~v~r~g~~~~~~~~~~~~~~-~~~~~~~~l~~~~~G~l~~l~~~~~~~~~~~~~~~~~~~~~evlV~V~  464 (1392)
                      |.+++..+...|++|+|.|+.+|+.+..... .....+.++....+|.+++|+|.+.+....+.     +.++||+|+|+
T Consensus      1493 ~~~~~~~~~~~~~~r~~~~~~~R~~~~~~~~~~~~~~~~~l~~~~~g~l~sl~~~~~~~~~~~~-----l~~~eVlVkV~ 1567 (2512)
T 2vz8_A         1493 LQKVLQGDLVMNVYRDGAWGAFRHFPLEQDRPEKQTEHAFVNVLSRGDLSSIRWVCSPLHYALP-----ASCQDRLCSVY 1567 (2512)
T ss_dssp             HHHHHHSCCSEEEEETTEEEEECCEECCCCCCEEEESCEEEEESSTTCTTSEEEEECTTTTCCC-----HHHHTTEEEEE
T ss_pred             HHHHHhcCCceEEEEcCccceEEEeecccccccccccceEEEccCCCCcCceEEEecCcccccC-----CCCCceEEEEE
Confidence            8888888888999999999999887655221 11235568999999999999999877533110     23789999999


Q ss_pred             EEecChhhHHHhcCCCChhhhhhhccccccccceeeEEEEeeCCCeEEEeecCCcccceEEecccceEEcCCCCCHhhHh
Q psy1119         465 YSSINFRDIMLTTAKLAPEVIESRRLYQHCVIGFEYSGRLRDSGKRVMGLTSGRSLANCCETDVEMAWEIPDQWTLEDAA  544 (1392)
Q Consensus       465 a~gln~~Dv~~~~G~~~~~~~~~~~~~~p~~lG~E~sGvV~~vGdrV~gl~~~g~~a~~v~~~~~~~~~iPd~ls~e~AA  544 (1392)
                      |+||||+|++++.|.++....+......++++|+|++|+|. +||+|+++...|+|++|+++|+..++++|+++|+++||
T Consensus      1568 aaglN~~Dv~~~~G~~~~~~~p~~~~~~~~~lG~E~aG~V~-vGdrV~g~~~~G~~Aeyv~vp~~~v~~iPd~ls~~eAA 1646 (2512)
T 2vz8_A         1568 YTSLNFRDVMLATGKLSPDSIPGKWLTRDCMLGMEFSGRDA-SGRRVMGMVPAEGLATSVLLLQHATWEVPSTWTLEEAA 1646 (2512)
T ss_dssp             EEECCHHHHHHHHTSSCGGGCCSCCSCSSSCCCCEEEEEET-TSCCEEEECSSCCSBSEEECCGGGEEECCTTSCHHHHT
T ss_pred             ecccCHHHHHHHhCCCccccccccccccCCceEEEEEEEEc-cCCEEEEeecCCceeeEEEcccceEEEeCCCCCHHHHH
Confidence            99999999999999887543332233457899999999997 99999999888999999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHhcCCCCCCEEEEEcCCchHHHHHHHHHHHcCCEEEEEecChhhHHHHHHHCCCCCcCceeeCCCc
Q psy1119         545 TVPCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMDAEIFTTVGTPEKREFIRKTFPFIKEENIGNSRDT  624 (1392)
Q Consensus       545 ~lp~~~~TA~~aL~~~a~l~~GetVLI~ga~GgVG~aaIqlA~~~Ga~V~~tv~s~ek~~~l~~~~p~l~~~~i~~s~~~  624 (1392)
                      ++|++++|||+++...+++++|++||||||+|+||++++|+|++.|++||+|+++++|++++++.++++++++++|+++.
T Consensus      1647 ~lp~~~~TA~~al~~~a~l~~Ge~VLI~gaaGgVG~aAiqlAk~~Ga~Viat~~s~~k~~~l~~~~~~lga~~v~~~~~~ 1726 (2512)
T 2vz8_A         1647 SVPIVYTTAYYSLVVRGRMQPGESVLIHSGSGGVGQAAIAIALSRGCRVFTTVGSAEKRAYLQARFPQLDETCFANSRDT 1726 (2512)
T ss_dssp             TSHHHHHHHHHHHTTTTCCCTTCEEEETTTTSHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHHHCTTCCSTTEEESSSS
T ss_pred             HhHHHHHHHHHHHHHHhcCCCCCEEEEEeCChHHHHHHHHHHHHcCCEEEEEeCChhhhHHHHhhcCCCCceEEecCCCH
Confidence            99999999999999899999999999999999999999999999999999999999999999998877899999999999


Q ss_pred             cHHHHHHHHcCCCcceEEEecCchhHHHHHHhcccCCeEEEEEcccccccCccccccccCCCcEEEEEechhhhhhCHHH
Q psy1119         625 SFEQLVMKRTKGRGVDLVLNSLAEEKLQASVRCLAQGGRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEW  704 (1392)
Q Consensus       625 ~~~~~i~~~T~g~GvDvVlds~~~~~l~~s~~~La~~Gr~v~iG~~~~~~~~~l~~~~~~k~~s~~g~~~~~~~~~~~~~  704 (1392)
                      +|.+.+++.|+|+|+|+|||+++++.++.+++||+++||++.+|..+......+.+..+.+++++.++.+..+....+..
T Consensus      1727 ~~~~~i~~~t~g~GvDvVld~~g~~~l~~~l~~L~~~Gr~V~iG~~~~~~~~~~~~~~~~~~~~~~g~~l~~~~~~~~~~ 1806 (2512)
T 2vz8_A         1727 SFEQHVLRHTAGKGVDLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHALGMAVFLKNVTFHGILLDSLFEEGGAT 1806 (2512)
T ss_dssp             HHHHHHHHTTTSCCEEEEEECCCHHHHHHHHTTEEEEEEEEECCCHHHHTTCEEEGGGGGGCCEEEECCGGGTTSSCCHH
T ss_pred             HHHHHHHHhcCCCCceEEEECCCchHHHHHHHhcCCCcEEEEeecccccccCcccccccccCCcEEEeeHHHHhhhCHHH
Confidence            99999999999999999999999999999999999999999999876555555567788899999999876655545555


Q ss_pred             HHHHHHHHHHHHHcCCCCCcceeeeccccHHHHHHHHHcCCccceEEEEecCCCCccccCCcccc--cccCCccccCCCC
Q psy1119         705 KMSLQKALQKAIDAGAVQPLVRTIFPEDKVEEAFRYMAAGKHIGKVIIKIRDEEPTKICTPKVKQ--LLAVPRYYADSNK  782 (1392)
Q Consensus       705 ~~~~~~~~~~~l~~g~l~pl~~~vf~l~ev~eA~~~l~~g~~~GKvVI~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~  782 (1392)
                      ...+.+.+..++.+|.++|+++++|+++++++||+.++++++.||+||.++++... ....+..+  ++..++.+|++++
T Consensus      1807 ~~~~l~~l~~~~~~g~l~p~i~~~f~l~ei~eA~~~l~~g~~~GKvVi~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~k 1885 (2512)
T 2vz8_A         1807 WQEVSELLKAGIQEGVVQPLKCTVFPRTKVEAAFRYMAQGKHIGKVVIQVREEEQG-PAPRGLPPIALTGLSKTFCPPHK 1885 (2512)
T ss_dssp             HHHHHHHHHHHHTTTCSCCCCEEEEESSTHHHHHHHHHTTCCSSEEEEECSCCCCS-SCCCCCCCCCEEEECCCCCCTTC
T ss_pred             HHHHHHHHHHHHHcCCcCCCcceEecHHHHHHHHHhhhccCccceEEEECCCcccc-cccccccccccccccccccCCCC
Confidence            66777778788889999999999999999999999999999999999999765332 11100000  1223456789999


Q ss_pred             eEEEEcCcchHHHHHHHHHHHhCCceEEEecCCCcccHHHHHHHHHHhcCCceEEEEeccCCCHHHHHHHHHHHhhcCCc
Q psy1119         783 SYIICGGLGGFGLELADWLVLRGARKLVLTSRSGVKNGYQALRIKIWKSYDVQVLISTDDITTEAGVVNLLTEANKLGPV  862 (1392)
Q Consensus       783 ~ylItGG~gGiG~~lA~~La~~GAr~lvl~sRs~~~~~~~~~~~~~l~~~G~~v~~~~~Dv~~~~~v~~l~~~~~~~g~I  862 (1392)
                      +||||||+||||+++|+||+++||++|++++|++...+...+.+++++..|+++.+++|||+|.++++++++++.++|+|
T Consensus      1886 ~~lITGgs~GIG~aia~~la~~Ga~~vvl~~R~~~~~~~~~~~~~~l~~~g~~v~~~~~Dvsd~~~v~~~~~~~~~~g~i 1965 (2512)
T 2vz8_A         1886 SYVITGGLGGFGLQLAQWLRLRGAQKLVLTSRSGIRTGYQARQVREWRRQGVQVLVSTSNASSLDGARSLITEATQLGPV 1965 (2512)
T ss_dssp             EEEEESTTSHHHHHHHHHHHHTTCCEEEEECSSCCCSHHHHHHHHHHHHTTCEEEEECCCSSSHHHHHHHHHHHHHHSCE
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEEEeCCCcchHHHHHHHHHHHhCCCEEEEEecCCCCHHHHHHHHHHHHhcCCC
Confidence            99999999999999999999999999999999987766666777888888999999999999999999999998778999


Q ss_pred             cEEEECcccCCCccccCCCHHHHHHHHhhHhHHHHHHHHHHhhhCCCCCeEEEecccccccCCCCChhHHHHHHHHHHHH
Q psy1119         863 DGIFNLAVVLKDALFENQTPEDFNASLGPKANATKYFDKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMANSIMERIC  942 (1392)
Q Consensus       863 ~gvi~~Agv~~d~~~~~~t~e~~~~~~~~kv~g~~~L~~~~~~~~~~l~~fV~~SS~s~~~G~~gq~~Yaaana~ld~la  942 (1392)
                      |+||||||++.++++.+++.++|++++++|+.|+|+|++++.+.++.+++||++||+++..|++||++|+|||+++++|+
T Consensus      1966 d~lVnnAgv~~~~~~~~~t~e~~~~~~~~nv~g~~~l~~~~~~~~~~~g~iV~iSS~ag~~g~~g~~~Y~aaKaal~~l~ 2045 (2512)
T 2vz8_A         1966 GGVFNLAMVLRDAVLENQTPEFFQDVSKPKYSGTANLDRVTREACPELDYFVIFSSVSCGRGNAGQANYGFANSAMERIC 2045 (2512)
T ss_dssp             EEEEECCCC----------------CTTTTHHHHHHHHHHHHHHCTTCCEEEEECCHHHHTTCTTCHHHHHHHHHHHHHH
T ss_pred             cEEEECCCcCCCCchhhCCHHHHHHHHHHHHHHHHHHHHHHHHhcccCCEEEEecchhhcCCCCCcHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999888878899999999999999999999999999999999


Q ss_pred             HHHHHcCCCeEEEEccccCccccccchhhhhHHHHHcCccccchhhhHHHHHHHHccCCCeEEehhhhhhh----cCCCC
Q psy1119         943 EARRAEGLPGLAVEWGAVGEVGLVADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEPIVASMVVAEKK----AGSGG 1018 (1392)
Q Consensus       943 ~~r~~~Glp~~ai~~g~~~~~G~~~~~~~~~~~~~~~g~~~~~~~~~l~~l~~~l~~~~~~~~~~~~~~~~----~~~~~ 1018 (1392)
                      ++||++|+|+++++||+++++|+++++.. ...+...|..++.+.++++.++.++.++.|.+.++...+..    .....
T Consensus      2046 ~~rr~~Gl~~~a~~~g~~~~~G~~~~~~~-~~~~~~~g~~~~~~~~~l~~l~~~~~~~~p~~~~~~~~~~~~~~~~~~~~ 2124 (2512)
T 2vz8_A         2046 EKRRHDGLPGLAVQWGAIGDVGVVLETMG-TNDTVIGGTLPQRIASCLEVLDLFLSQPHPVLSSFVLAEKKAAAPRDGSS 2124 (2512)
T ss_dssp             HHHHHTTSCCCEEEECCBCTTSTTTC-----CCCCTTSEECBCHHHHHHHHHHHHTCSCSEEEEEEECC-----------
T ss_pred             HHHHHCCCcEEEEEccCcCCcchhhhcch-hHHHHhhcccCccHHHHHHHHHHHhhCCCcccchhhhcccccccccccch
Confidence            99999999999999999999999998655 33344567778888899999999999888988776543221    11112


Q ss_pred             cchHHHHHHHHhCCCCCcccCcCcchhhcCcchhhHHHHHHHHHHHhCCccChhhhccCCHHHHHHHHhcccCCCCCCCc
Q psy1119        1019 ATNIVDAVINILGLRDLKTVSLHSTLAELGMDSMMAVEIKQTLEREFEVFLTPQDIRGLTFAKLQDIAVSFENDDKSKPV 1098 (1392)
Q Consensus      1019 ~~~l~~~~a~~l~~~~~~~i~~~~~l~~lG~DSL~avel~~~l~~~~~~~l~~~~i~~~ti~~La~~~~~~~~~~~~~~~ 1098 (1392)
                      .+.++++|+++|++.+.++|+++++|++||+|||+|+|||+||+++||+++++.+|..+|+.+|++++............
T Consensus      2125 ~~~l~~~~a~vL~~~~~~~i~~~~~~~~lG~DSL~avelr~~i~~~~~~~l~~~~i~~~t~~~la~~~~~~~~~~~~~~~ 2204 (2512)
T 2vz8_A         2125 QKDLVKAVAHILGIRDVASINPDSTLVDLGLDSLMGVEVRQILEREHDLVLSMREVRQLSLRKLQELSSKTSTDADPATP 2204 (2512)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHHHHHHhCCCcccccCCCCchHHhCcchHHHHHHHHHHHHHhCCcccHHHHHhhhHHHHHHHHhhcccccccccc
Confidence            35699999999998656789999999999999999999999999999999999999779999999887654322110000


Q ss_pred             cccccCCcccccccCCCChhhHHHHHHhhccccccCCcccccCCccCCCCccccCCCCCceeEeecCCCccccccHHHHh
Q psy1119        1099 STEASGGQVTALSVEDIPDVGIQYLMRTIGDEILANKPVIRLPSLKNNGSTVEEPVGNNNTIFMVPGIEGIATVLEPLAK 1178 (1392)
Q Consensus      1099 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~g~~~pLF~vp~agG~~~~y~~La~ 1178 (1392)
                      ....   ...      .. ............ .....++++|++.          ++.++|||||||+||.+++|.+|++
T Consensus      2205 ~~~~---~~~------~~-~~~~~~~~~~~~-~~~~~~lv~l~~~----------~~~~~~Lfc~~~agG~~~~y~~l~~ 2263 (2512)
T 2vz8_A         2205 TSHE---DSP------VR-QQATLNLSTLLV-NPEGPTLTRLNSV----------QSAERPLFLVHPIEGSITVFHGLAA 2263 (2512)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             cccc---ccc------cc-cccccccccccc-cccCceeeecccc----------cCCCCCeEEeCCccccHHHHHHHHH
Confidence            0000   000      00 000000000000 0001123333321          2234799999999999999999999


Q ss_pred             hcCCceEEEecCCCCCCCCHHHHHHHHHHHHhhhccCCCCcEEEEeechhHHHHHHHHHHHHHcCCcc----EEEEEeCC
Q psy1119        1179 NINAQVLVFQFDHTNPPDTIPEMADSLLPHFKKRLVHGTDEIKLVGFSFGGMVALELAIKLEQLGTKC----HLYLVDSA 1254 (1392)
Q Consensus      1179 ~L~~~~~v~~l~~e~~~~sieelA~~y~~~I~~~q~qp~gPy~L~G~S~Gg~VA~EmA~~Le~~G~~v----~LvLiD~~ 1254 (1392)
                      +|+.+++.+++.++++..++++||++|++.|++.  +|+|||+|+||||||+||||||++|+++|.++    .|+++|+.
T Consensus      2264 ~l~~~v~~lq~pg~~~~~~i~~la~~~~~~i~~~--~p~gpy~L~G~S~Gg~lA~evA~~L~~~G~~v~~~~~L~llDg~ 2341 (2512)
T 2vz8_A         2264 KLSIPTYGLQCTGAAPLDSIQSLASYYIECIRQV--QPEGPYRIAGYSYGACVAFEMCSQLQAQQSATPGNHSLFLFDGS 2341 (2512)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             hhCCcEEEEecCCCCCCCCHHHHHHHHHHHHHHh--CCCCCEEEEEECHhHHHHHHHHHHHHHcCCCCCccceEEEEeCc
Confidence            9984444444457778899999999999999864  48999999999999999999999999999887    57899985


Q ss_pred             CCCCcc--------c-------------------cCCCC------------ChHHHHHHHHhcCCccc-cCCHHHHHHHH
Q psy1119        1255 PDYVLT--------S-------------------LRKLP------------DWNAKLNYFLDLMPEDA-THSRTYQRNLA 1294 (1392)
Q Consensus      1255 p~~~~~--------~-------------------l~~~~------------~~~~~l~~~~~~~~~~~-~~~~~~l~~~~ 1294 (1392)
                      |.....        .                   +....            .+.+.+..+.+.+.... ..+++.++.+.
T Consensus      2342 ~~~~~~~~~p~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~l~~e~l~~~~ 2421 (2512)
T 2vz8_A         2342 HTFVLAYTQSVRAKMTPGCEAEAEAKAMYFFVQQFTDMEQGKVLEALIPLQGLEARVAATVDLITQSHAGLDRHALSFAA 2421 (2512)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             hHHHHHHhhhhccccCccccchhhHHHHHHHHHHhhhccchhhhhhhcccccHHHHHHHHHHHhhhcccccCHHHHHHHH
Confidence            432100        0                   00000            00000111111111101 11567788889


Q ss_pred             HHHHHHHHhhccccCCCCCcccceEEEEeeCCCC-CC--ChhhcCcccccCCCeEEEEEccCccccccChHHHHHHHhhh
Q psy1119        1295 HAAYKRITSILKYTDPKHKAFGGNITLLRPTEQA-LP--TAEDYGLSKVCKKPVKVHFVDGNHFTVLDNIKSAQIIMHED 1371 (1392)
Q Consensus      1295 ~~~~~~~~~~~~y~~~~~~~~~~pi~l~~a~~~~-~~--~~~~~~W~~~~~g~v~v~~v~G~H~~ml~~~~~~~i~~~l~ 1371 (1392)
                      +.+++++++...|+|..  ++++||++|+++++. ..  ...+++|++++++.++++.+||+||+|++++++..++..|+
T Consensus      2422 ~~~r~d~~~~~~Y~p~~--~l~~pI~lf~a~~d~~~~~~~~~~~~W~~~t~g~~~v~~v~G~H~~ml~~~~v~~la~~L~ 2499 (2512)
T 2vz8_A         2422 RSFYQKLRAAENYWPQA--TYHGNVTLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESILSIIH 2499 (2512)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHHHHHHhcCCCC--CccCCEEEEEecCCCcccccccccccHHHhcCCCcEEEEECCCchHhhCCccHHHHHHHHH
Confidence            99999999999998753  799999999998775 22  24568999999999999999999999999999889999999


Q ss_pred             cccCCC
Q psy1119        1372 STDFKT 1377 (1392)
Q Consensus      1372 ~~L~~~ 1377 (1392)
                      ..|..+
T Consensus      2500 ~~L~~~ 2505 (2512)
T 2vz8_A         2500 SCLAEP 2505 (2512)
T ss_dssp             ------
T ss_pred             HHHhhc
Confidence            888764



>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3kg6_A CURF; polyketide synthase, double hotdog fold, dehydratase, lyase; 2.70A {Lyngbya majuscula} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3kg8_A CURJ; polyketide synthase, double hotdog fold, dehydratase, lyase; 2.45A {Lyngbya majuscula} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3kg9_A CURK; polyketide synthase, double hotdog fold, dehydratase, lyase; 1.70A {Lyngbya majuscula} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3el6_A Erythromycin dehydratase; dehydratase double hotdog fold CIS-proline, acyltransferase, antibiotic biosynthesis; 1.85A {Saccharopolyspora erythraea} Back     alignment and structure
>3kg7_A CURH; polyketide synthase, double hotdog fold, dehydratase, lyase; 2.77A {Lyngbya majuscula} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3hrq_A PKS, aflatoxin biosynthesis polyketide synthase; hot-DOG fold, iterative type I PKS, norsolorinic acid, product template domain; HET: PLM; 1.80A {Aspergillus parasiticus} PDB: 3hrr_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>4i4d_A Peptide synthetase NRPS type II-PCP; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MLY; 2.10A {Streptomyces verticillus} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1dny_A Non-ribosomal peptide synthetase peptidyl carrier protein; four-helix bundle, modular enzyme, domain, flexible region; NMR {Brevibacillus brevis} SCOP: a.28.1.2 PDB: 2gdw_A 2gdx_A 2gdy_A 2k2q_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2ju1_A Erythronolide synthase; carrier protein domain, modular polyketide synthase, alpha- helical bundle, acyltransferase; NMR {Saccharopolyspora erythraea} PDB: 2ju2_A Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Back     alignment and structure
>2cq8_A 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH, PP-binding, acyl carrier protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2liu_A CURA; holo state, transferase; NMR {Lyngbya majuscula} PDB: 2liw_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1392
d1pqwa_183 c.2.1.1 (A:) Putative enoyl reductase domain of po 5e-27
d1gu7a2189 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yea 4e-23
d1qora2179 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escher 7e-19
d2fr1a1259 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI 2e-18
d1xkta_286 c.69.1.22 (A:) Fatty acid synthase {Human (Homo sa 8e-16
d1xa0a2176 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Ba 4e-15
d1mo2a_255 c.69.1.22 (A:) Erythromycin polyketide synthase {S 2e-14
d2pnga176 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP d 3e-14
d1kola2195 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Ps 4e-14
d2jhfa2176 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse ( 6e-14
d1jmkc_230 c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillu 7e-14
d1h2ba2172 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeo 5e-13
d2fzwa2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 5e-13
d1iz0a2171 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus 6e-13
d1yb5a2174 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human 6e-13
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 2e-12
d1v3va2182 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehyd 2e-12
d1vj0a2182 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {T 4e-12
d1jqba2174 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol 4e-12
d1tt7a2167 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bac 8e-12
d1f8fa2174 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase { 8e-12
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 1e-11
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 6e-11
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 7e-11
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 1e-10
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 1e-10
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 1e-10
d1o8ca277 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Esc 2e-10
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 2e-10
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 3e-10
d1cdoa2175 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Ga 5e-10
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 5e-10
d1p0fa2174 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog 6e-10
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 8e-10
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 1e-09
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 2e-09
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 3e-09
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 5e-09
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 5e-09
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 5e-09
d1o89a2177 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Esc 6e-09
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 7e-09
d1gz6a_302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 7e-09
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 1e-08
d1tt7a1162 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein 2e-08
d2h7xa1283 c.69.1.22 (A:9-291) Picromycin polyketide synthase 2e-08
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 2e-08
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 2e-08
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 3e-08
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 3e-08
d1rjwa2168 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillu 4e-08
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 4e-08
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 5e-08
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 6e-08
d1e3ia2174 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse ( 6e-08
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 6e-08
d1cdoa1199 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase 7e-08
d1d1ta2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 1e-07
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 1e-07
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 2e-07
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 2e-07
d1uufa2168 c.2.1.1 (A:145-312) Hypothetical protein YahK {Esc 2e-07
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 2e-07
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 5e-07
d1gu7a1175 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA redu 5e-07
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 1e-06
d1vj1a2187 c.2.1.1 (A:125-311) Putative zinc-binding alcohol 1e-06
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 2e-06
d1kola1201 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrog 2e-06
d1pl8a2171 c.2.1.1 (A:146-316) Ketose reductase (sorbitol deh 2e-06
d1iz0a1131 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase 2e-06
d1xa0a1152 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homo 2e-06
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 3e-06
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 3e-06
d1llua2166 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudom 4e-06
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 5e-06
d1jvba2170 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeo 7e-06
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 8e-06
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 9e-06
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 1e-05
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-05
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 2e-05
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-05
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 2e-05
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 5e-05
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 7e-05
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 1e-04
d1piwa2168 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase 2e-04
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 2e-04
d1pl8a1185 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor 2e-04
d1e3ja1178 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor 3e-04
d1yb5a1150 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductas 5e-04
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 5e-04
d1ulua_256 c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermoph 0.001
d1h2ba1171 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenas 0.001
d1dv5a_80 a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactob 0.001
d1mxha_266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 0.001
d1thta_302 c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase 0.002
d2jq4a183 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Ag 0.002
d2fzwa1197 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase 0.003
d1klpa_115 a.28.1.1 (A:) Acyl carrier protein {Mycobacterium 0.003
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: Putative enoyl reductase domain of polyketide synthase
species: Mycobacterium tuberculosis [TaxId: 1773]
 Score =  107 bits (267), Expect = 5e-27
 Identities = 64/184 (34%), Positives = 103/184 (55%), Gaps = 4/184 (2%)

Query: 541 EDAATVPCVYATAVYAMFICGQMQKGESILIHAGSGGVGQAAINLARYMDAEIFTTVGTP 600
            +AAT    Y TA +++   G++  GE +LIH+ +GGVG AA+++A+ + A I+TT G+ 
Sbjct: 1   NEAATFGVAYLTAWHSLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSD 60

Query: 601 EKREFIRKTFPFIKEENIGNSRDTSFEQLVMKRTKGRGVDLVLNSLAEEKLQASVRCLAQ 660
                 R+    +  E +G+SR   F   +++ T G GVD+VLNSLA E +Q  V+ LA 
Sbjct: 61  ----AKREMLSRLGVEYVGDSRSVDFADEILELTDGYGVDVVLNSLAGEAIQRGVQILAP 116

Query: 661 GGRFLEIGKFDLANNNMLGMEVFMRETSFHGVMLDNFFFAEQEWKMSLQKALQKAIDAGA 720
           GGRF+E+GK D+  +  LG+    +  SF  V LD     +      L + + + +  G 
Sbjct: 117 GGRFIELGKKDVYADASLGLAALAKSASFSVVDLDLNLKLQPARYRQLLQHILQHVADGK 176

Query: 721 VQPL 724
           ++ L
Sbjct: 177 LEVL 180


>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 189 Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Length = 259 Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 286 Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 176 Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Length = 255 Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 76 Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 195 Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 176 Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Length = 230 Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 172 Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 171 Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Length = 182 Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 182 Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 174 Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 167 Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 174 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 77 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 175 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 174 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 177 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 162 Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Length = 283 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 174 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 168 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 175 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 187 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 201 Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 131 Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 152 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 166 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 170 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 168 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Length = 256 Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 171 Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Length = 80 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Length = 302 Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Length = 83 Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1392
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 100.0
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 99.95
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 99.94
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.93
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.92
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.92
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.92
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 99.92
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.91
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.91
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.91
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.91
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.91
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.91
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.91
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.91
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.91
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.91
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.91
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.91
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.91
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.9
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 99.9
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.9
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.9
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.9
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.9
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.9
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.9
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.9
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.9
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.89
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.89
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.89
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.89
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.88
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 99.88
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.88
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.88
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.88
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.88
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.87
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.87
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.87
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.87
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.87
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 99.87
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.87
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.86
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.86
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.86
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.86
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.86
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.85
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.85
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.85
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 99.85
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.84
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 99.84
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.84
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.84
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.84
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 99.83
d1iz0a1131 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.83
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.82
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.82
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.81
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.81
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.81
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.81
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.81
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.81
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.78
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.78
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.78
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.78
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.78
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.78
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.78
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.77
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.77
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.77
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.77
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.76
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.76
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.76
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.75
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.75
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.74
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.74
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.74
d1xa0a1152 B. subtilis YhfP homologue {Bacillus stearothermop 99.74
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.73
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.73
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.73
d1tt7a1162 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.7
d1piwa1192 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.7
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.69
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.69
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.68
d1o89a1146 Hypothetical protein YhdH {Escherichia coli [TaxId 99.67
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.65
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.65
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.65
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.65
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.61
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.6
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.6
d1gu7a1175 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.6
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.6
d2fzwa1197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.59
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 99.59
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.59
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.56
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.53
d1vj0a1184 Hypothetical protein TM0436 {Thermotoga maritima [ 99.53
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.49
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 99.44
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.36
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 99.3
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.25
d2pnga176 Type I fatty acid synthase ACP domain {Rat (Rattus 99.25
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.25
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 99.22
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.18
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.08
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.07
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.01
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 98.97
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 98.96
d2gdwa176 Peptidyl carrier protein (PCP), thioester domain { 98.95
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 98.94
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 98.93
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.89
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.88
d1vj1a1166 Putative zinc-binding alcohol dehydrogenase {Mouse 98.88
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 98.87
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 98.87
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.86
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 98.84
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 98.82
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.81
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 98.8
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 98.79
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 98.79
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 98.79
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 98.77
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 98.77
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 98.73
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 98.71
d1v3va1147 Leukotriene b4 12-hydroxydehydrogenase/prostagland 98.71
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 98.67
d2jq4a183 Hypothetical protein Atu2571 {Agrobacterium tumefa 98.67
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 98.65
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.64
d1vkua_85 Acyl carrier protein {Thermotoga maritima [TaxId: 98.64
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 98.64
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.63
d2af8a_86 Actinorhodin polyketide synthase acyl carrier prot 98.62
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 98.62
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 98.62
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 98.61
d1or5a_82 Frenolicin polyketide synthase acyl carrier protei 98.6
d1nq4a_95 Oxytetracycline polyketide synthase acyl carrier { 98.58
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 98.57
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 98.53
d1f80d_74 Acyl carrier protein {Bacillus subtilis [TaxId: 14 98.52
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.5
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 98.49
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 98.49
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 98.46
d1klpa_115 Acyl carrier protein {Mycobacterium tuberculosis [ 98.46
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 98.46
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 98.45
d1dv5a_80 apo-D-alanyl carrier protein {Lactobacillus casei 98.42
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 98.4
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.39
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 98.38
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 98.37
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 98.36
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 98.34
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.31
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 98.29
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 98.29
d1t8ka_77 Acyl carrier protein {Escherichia coli [TaxId: 562 98.27
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 98.27
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 98.25
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 98.2
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 98.08
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 98.08
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 98.06
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.03
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 97.86
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 97.79
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 97.77
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 97.76
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 97.71
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 97.67
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 97.64
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 97.62
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 97.59
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 97.57
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 97.57
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 97.55
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 97.45
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 97.37
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 97.36
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 97.28
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 97.24
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 97.19
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.09
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 96.94
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 96.75
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 96.73
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 96.61
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 96.54
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 96.54
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 96.48
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 96.45
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 96.36
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 96.29
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 96.23
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 96.22
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.2
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.19
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 96.19
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 96.17
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 96.16
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 96.14
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 96.14
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 96.12
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 96.1
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 96.08
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 96.05
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 96.0
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 95.95
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 95.93
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 95.91
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 95.88
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 95.86
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 95.85
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 95.75
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 95.69
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 95.65
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 95.64
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 95.51
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 95.49
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.49
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 95.47
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.46
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 95.45
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 95.45
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 95.43
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.39
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 95.38
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.37
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 95.34
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 95.29
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.28
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 95.28
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 95.26
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 95.21
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 95.18
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 95.17
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 95.17
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 95.1
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.1
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 95.08
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 95.01
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 94.97
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 94.97
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 94.96
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 94.93
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 94.9
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 94.89
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 94.88
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 94.73
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 94.71
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 94.69
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 94.68
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 94.66
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 94.66
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 94.57
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 94.51
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 94.28
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 94.19
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 94.16
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.13
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 94.12
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 94.07
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 94.04
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 93.98
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 93.98
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 93.87
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 93.85
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 93.82
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 93.72
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 93.7
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 93.67
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 93.67
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 93.64
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 93.54
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 93.48
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.47
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 93.31
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 93.25
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 93.22
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 93.19
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 93.19
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 93.13
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 93.05
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 93.03
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 92.98
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 92.94
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 92.9
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 92.59
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 92.58
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 92.49
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.43
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 92.25
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.24
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 92.18
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 92.15
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 92.1
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 91.93
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 91.89
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 91.64
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 91.6
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 91.58
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 91.27
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 91.24
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.9
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 90.87
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 90.72
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 90.65
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 90.47
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 90.42
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 90.32
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 90.29
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 90.18
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 90.1
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 90.08
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 89.59
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 89.4
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 89.22
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 89.22
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 88.77
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 88.76
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 88.73
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 88.66
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 88.57
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 87.69
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 87.6
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 87.37
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 87.16
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 86.82
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 86.79
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 86.67
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 86.3
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 86.13
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 85.86
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 85.77
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 85.76
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 85.7
d1id1a_153 Rck domain from putative potassium channel Kch {Es 85.68
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 85.59
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 85.56
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 85.36
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 85.3
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 85.3
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 85.06
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 84.98
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 84.91
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 84.75
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 84.47
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 84.42
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 84.33
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 84.3
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 84.06
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 84.02
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 83.82
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 83.81
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 83.67
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 83.56
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 83.43
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 83.42
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 83.23
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 82.93
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 82.9
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 82.85
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 82.68
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 82.34
d2fr1a2209 Erythromycin synthase, eryAI, 1st ketoreductase mo 82.21
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 82.13
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 82.13
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 82.09
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 82.03
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 81.96
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 81.82
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 81.71
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 81.68
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 81.45
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 81.17
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 80.68
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 80.64
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 80.55
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 80.5
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 80.44
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 80.39
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 80.22
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 80.14
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 80.11
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 80.09
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 80.03
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Erythromycin synthase, eryAI, 1st ketoreductase module
species: Saccharopolyspora erythraea [TaxId: 1836]
Probab=100.00  E-value=3.8e-33  Score=314.28  Aligned_cols=223  Identities=25%  Similarity=0.400  Sum_probs=195.1

Q ss_pred             cccCCCCeEEEEcCcchHHHHHHHHHHHhCCceEEEecCCCcccHHHHHHHHHHhcCCceEEEEeccCCCHHHHHHHHHH
Q psy1119         776 YYADSNKSYIICGGLGGFGLELADWLVLRGARKLVLTSRSGVKNGYQALRIKIWKSYDVQVLISTDDITTEAGVVNLLTE  855 (1392)
Q Consensus       776 ~~~~~~~~ylItGG~gGiG~~lA~~La~~GAr~lvl~sRs~~~~~~~~~~~~~l~~~G~~v~~~~~Dv~~~~~v~~l~~~  855 (1392)
                      ..|+|++|||||||+||||+++|++|+++|+++|++++|++.+.+..++.+++++..|+++.++.||++|.++++++++.
T Consensus         4 ~~~~p~gt~lVTGgs~GIG~a~a~~la~~Ga~~vvl~~R~~~~~~~~~~~~~~l~~~g~~v~~~~~Dv~d~~~~~~~~~~   83 (259)
T d2fr1a1           4 DEWKPTGTVLVTGGTGGVGGQIARWLARRGAPHLLLVSRSGPDADGAGELVAELEALGARTTVAACDVTDRESVRELLGG   83 (259)
T ss_dssp             CCCCCCSEEEEETTTSHHHHHHHHHHHHHTCSEEEEEESSGGGSTTHHHHHHHHHHTTCEEEEEECCTTCHHHHHHHHHT
T ss_pred             cccCCcCEEEEECCCcHHHHHHHHHHHHCCCCEEEEEeCCccCHHHHHHHHHHHHhccccccccccccchHHHHHHhhcc
Confidence            35899999999999999999999999999999999999998777777788888999999999999999999999999999


Q ss_pred             HhhcCCccEEEECcccCCCccccCCCHHHHHHHHhhHhHHHHHHHHHHhhhCCCCCeEEEecccccccCCCCChhHHHHH
Q psy1119         856 ANKLGPVDGIFNLAVVLKDALFENQTPEDFNASLGPKANATKYFDKYSRTMCPTLGQFVVFSSVSCGRGNAGQTNYGMAN  935 (1392)
Q Consensus       856 ~~~~g~I~gvi~~Agv~~d~~~~~~t~e~~~~~~~~kv~g~~~L~~~~~~~~~~l~~fV~~SS~s~~~G~~gq~~Yaaan  935 (1392)
                      +.+.++|++||||||+..+.++.+++.++|+.++++|+.|+++|++++.+.  +.++||++||+++..|++||++|+|+|
T Consensus        84 i~~~~~i~~vv~~ag~~~~~~~~~~~~~~~~~~~~~~~~g~~~l~~~~~~~--~~~~iv~~SS~a~~~g~~~~~~YaAak  161 (259)
T d2fr1a1          84 IGDDVPLSAVFHAAATLDDGTVDTLTGERIERASRAKVLGARNLHELTREL--DLTAFVLFSSFASAFGAPGLGGYAPGN  161 (259)
T ss_dssp             SCTTSCEEEEEECCCCCCCCCGGGCCHHHHHHHTHHHHHHHHHHHHHHTTS--CCSEEEEEEEHHHHTCCTTCTTTHHHH
T ss_pred             ccccccccccccccccccccccccccHHHHHHHhhhhccchhHHHHHhhcc--CCceEeeecchhhccCCcccHHHHHHH
Confidence            877789999999999999999999999999999999999999999987653  668999999999999999999999999


Q ss_pred             HHHHHHHHHHHHcCCCeEEEEccccCccccccchhhhhHHHHHcCccccchhhhHHHHHHHHccCCC
Q psy1119         936 SIMERICEARRAEGLPGLAVEWGAVGEVGLVADMAEDNLEVVIGGTLQQRISNCLECLNEFLIQSEP 1002 (1392)
Q Consensus       936 a~ld~la~~r~~~Glp~~ai~~g~~~~~G~~~~~~~~~~~~~~~g~~~~~~~~~l~~l~~~l~~~~~ 1002 (1392)
                      +|+++|+++++.+|+++.+|+||+|.+.||..+...  ..+...|..++.++++.+.++.++....+
T Consensus       162 a~l~~la~~~~~~Gi~v~~I~pg~~~~~g~~~~~~~--~~~~~~G~~~~~~~~~~~~l~~~l~~~~~  226 (259)
T d2fr1a1         162 AYLDGLAQQRRSDGLPATAVAWGTWAGSGMAEGPVA--DRFRRHGVIEMPPETACRALQNALDRAEV  226 (259)
T ss_dssp             HHHHHHHHHHHHTTCCCEEEEECCBC--------------CTTTTEECBCHHHHHHHHHHHHHTTCS
T ss_pred             HhHHHHHHHHHhCCCCEEECCCCcccCCccccchHH--HHHHhcCCCCCCHHHHHHHHHHHHhCCCc
Confidence            999999999999999999999999999999765422  23345677788889999999988876654



>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2gdwa1 a.28.1.2 (A:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fr1a2 c.2.1.2 (A:1448-1656) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure