Diaphorina citri psyllid: psy111


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
SVVVNDRWCNTCLCKHGGYLTCEDKYNPGKFQSRKFENCFTLDKYSWGYRRDANIDDILNMTEVLQTMMNTVSFGDKTLSILFSV
cEEEccccccccccccccCCccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEccc
SVVVNDRWCNTCLCKHGGYLTCEDKYNPGKFQSRKFENCFTLDKYSWGYRRDANIDDILNMTEVLQTMMNTVSFGDKTLSILFSV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SVVVNDRWCNTCLCKHGGYLTCEDKYNPGKFQSRKFENCFTLDKYSWGYRRDANIDDILNMTEVLQTMMNTVSFGDKTLSILFSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Plasma alpha-L-fucosidase Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.confidentQ6AYS4
Plasma alpha-L-fucosidase Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.confidentQ99KR8
Alpha-L-fucosidase Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.confidentC3YWU0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005575 [CC]cellular_componentprobable
GO:0015928 [MF]fucosidase activityprobableGO:0016787, GO:0003824, GO:0003674, GO:0016798, GO:0004553

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WVV, chain A
Confidence level:very confident
Coverage over the Query: 1-83
View the alignment between query and template
View the model in PyMOL