Diaphorina citri psyllid: psy11204

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-

MPKLSHFDEKGGVVKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQGKLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMKKKMDLEKFQIENPGFDFSRAKLAKCYDKVQDPPTS

ccccccccccccccccccccEEEEEEccEEEEEEEcccccccccEEEEEEccEEEEEEccEECccccccccccccccEEEEEcccEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEccccccccccccc

**********GGVVKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQGKLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMKKKMDLEKFQIENPGFDFSRAKLAKCY*********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MPKLSHFDEKGGVVKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQGKLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMKKKMDLEKFQIENPGFDFSRAKLAKCYDKVQDPPTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
NudC domain-containing protein 2		confident	Q5M823
NudC domain-containing protein 2		confident	Q9CQ48
NudC domain-containing protein 2		confident	Q8WVJ2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005856 [CC]	cytoskeleton	probable	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0000776 [CC]	kinetochore	probable	GO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RH0, chain A
Confidence level:very confident
Coverage over the Query: 7-144
View the alignment between query and template
View the model in PyMOL