Psyllid ID: psy11204

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MPKLSHFDEKGGVVKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQGKLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMKKKMDLEKFQIENPGFDFSRAKLAKCYDKVQDPPTS
ccccccccccccccccccccEEEEEEccEEEEEEEcccccccccEEEEEEccEEEEEEccEEEccccccccccccccEEEEEcccEEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEccccccccccccc
cccccccHHcccccccccEEEEEEEcccEEEEEEEccccccccEEEEEEEccEEEEEEcccccEcccccccccccccEEEEEcccEEEEEEEEEEccccccccHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccccEEccccccccccccc
mpklshfdekggvvkcptpwgswwqTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKElfqgklldvvhgDEIIWTLenngtllnivlpkaefkgkeQIWNSLFVnskenyatdptiFHEMKKKMDLekfqienpgfdfsraKLAKcydkvqdppts
mpklshfdekggvvkcptpwgswWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQGKLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMKKKMDLEKFQIENPGFDFSRAKLakcydkvqdppts
MPKLSHFDEKGGVVKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQGKLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMKKKMDLEKFQIENPGFDFSRAKLAKCYDKVQDPPTS
**********GGVVKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQGKLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMKKKMDLEKFQIENPGFDFSRAKLAKCY*********
*************VKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQGKLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMKKKMDLEKFQIENPGFDFSRAK**************
*********KGGVVKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQGKLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMKKKMDLEKFQIENPGFDFSRAKLAKCY*********
*********KGGVVKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQGKLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMKKKMDLEKFQIENPGFDFSRAKLAKCYDKV******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKLSHFDEKGGVVKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQGKLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMKKKMDLEKFQIENPGFDFSRAKLAKCYDKVQDPPTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query161 2.2.26 [Sep-21-2011]
Q5M823157 NudC domain-containing pr yes N/A 0.888 0.910 0.425 7e-29
Q8WVJ2157 NudC domain-containing pr yes N/A 0.888 0.910 0.425 8e-29
Q9CQ48157 NudC domain-containing pr yes N/A 0.888 0.910 0.425 1e-28
Q9STN7293 Protein BOBBER 2 OS=Arabi no N/A 0.782 0.430 0.222 0.0002
>sp|Q5M823|NUDC2_RAT NudC domain-containing protein 2 OS=Rattus norvegicus GN=Nudcd2 PE=2 SV=1 Back     alignment and function desciption
 Score =  126 bits (316), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 92/148 (62%), Gaps = 5/148 (3%)

Query: 7   FDEKGGVVKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQG 66
           F+E+ GVV C TPWG W+QTL+EVFIEV +    R++DI     +  ++  + G+E+ +G
Sbjct: 5   FEERSGVVPCATPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALAVGGREILKG 64

Query: 67  KLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMK 126
           KL D    DE  WTLE+   ++ IVL K + +     W SL    +  YA DP +  +M+
Sbjct: 65  KLFDSTIADEGTWTLEDR-KMVRIVLTKTK-RDAANCWTSLL---ESEYAADPWVQDQMQ 119

Query: 127 KKMDLEKFQIENPGFDFSRAKLAKCYDK 154
           +K+ LE+FQ ENPGFDFS A+++  Y K
Sbjct: 120 RKLTLERFQKENPGFDFSGAEISGNYTK 147

Rattus norvegicus (taxid: 10116)
>sp|Q8WVJ2|NUDC2_HUMAN NudC domain-containing protein 2 OS=Homo sapiens GN=NUDCD2 PE=1 SV=1 Back     alignment and function description
>sp|Q9CQ48|NUDC2_MOUSE NudC domain-containing protein 2 OS=Mus musculus GN=Nudcd2 PE=1 SV=1 Back     alignment and function description
>sp|Q9STN7|BOB2_ARATH Protein BOBBER 2 OS=Arabidopsis thaliana GN=BOB2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
427784863186 Putative nuclear distribution protein nu 0.931 0.806 0.541 7e-40
240848799156 nudC domain-containing protein 2 [Acyrth 0.931 0.961 0.493 2e-39
241595281181 NudC domain-containing protein, putative 0.919 0.817 0.513 1e-37
442750629184 Putative nuclear distribution protein nu 0.919 0.804 0.513 2e-37
346473873170 hypothetical protein [Amblyomma maculatu 0.931 0.882 0.535 1e-34
340379281155 PREDICTED: nudC domain-containing protei 0.894 0.929 0.477 2e-31
242011136174 NudC domain-containing protein, putative 0.919 0.850 0.486 2e-31
391339831161 PREDICTED: nudC domain-containing protei 0.931 0.931 0.451 6e-30
89270951160 NudC domain containing 2 [Xenopus (Silur 0.900 0.906 0.446 9e-29
62858511157 NudC domain containing 2 [Xenopus (Silur 0.900 0.923 0.446 9e-29
>gi|427784863|gb|JAA57883.1| Putative nuclear distribution protein nudc [Rhipicephalus pulchellus] Back     alignment and taxonomy information
 Score =  168 bits (425), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 102/155 (65%), Gaps = 5/155 (3%)

Query: 1   MPKLSHFDEKGGVVKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAG 60
           MP LSHFDE+ G V CPTPWG WWQT+ EVF E+ +    R +D+ I+     ISCT+ G
Sbjct: 1   MP-LSHFDERSGAVSCPTPWGRWWQTVGEVFAEIEVPKGTRGKDVRIQINPRHISCTVHG 59

Query: 61  KELFQGKLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPT 120
           KELF G L   V  DE  WT+E    +L I+L K+E    E++W SL    +  YA DP 
Sbjct: 60  KELFSGNLHRTVVADESTWTIEERQRVL-ILLVKSEPANSEKVWESLL---EGQYAPDPH 115

Query: 121 IFHEMKKKMDLEKFQIENPGFDFSRAKLAKCYDKV 155
           I HEM KK+DLEKFQIENPGFDFS AKL K YD++
Sbjct: 116 IMHEMMKKLDLEKFQIENPGFDFSGAKLDKLYDRI 150

Source: Rhipicephalus pulchellus

Species: Rhipicephalus pulchellus

Genus: Rhipicephalus

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|240848799|ref|NP_001155587.1| nudC domain-containing protein 2 [Acyrthosiphon pisum] gi|239791786|dbj|BAH72313.1| ACYPI004786 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|241595281|ref|XP_002404454.1| NudC domain-containing protein, putative [Ixodes scapularis] gi|215502344|gb|EEC11838.1| NudC domain-containing protein, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|442750629|gb|JAA67474.1| Putative nuclear distribution protein nudc [Ixodes ricinus] Back     alignment and taxonomy information
>gi|346473873|gb|AEO36781.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|340379281|ref|XP_003388155.1| PREDICTED: nudC domain-containing protein 2-like [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|242011136|ref|XP_002426311.1| NudC domain-containing protein, putative [Pediculus humanus corporis] gi|212510388|gb|EEB13573.1| NudC domain-containing protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|391339831|ref|XP_003744250.1| PREDICTED: nudC domain-containing protein 2-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|89270951|emb|CAJ83725.1| NudC domain containing 2 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|62858511|ref|NP_001016379.1| NudC domain containing 2 [Xenopus (Silurana) tropicalis] gi|166796665|gb|AAI58939.1| hypothetical protein LOC549133 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
UNIPROTKB|E1BUG9157 NUDCD2 "Uncharacterized protei 0.888 0.910 0.439 2.1e-29
UNIPROTKB|Q32KU8157 NUDCD2 "NudC domain containing 0.888 0.910 0.425 1.9e-28
UNIPROTKB|Q8WVJ2157 NUDCD2 "NudC domain-containing 0.888 0.910 0.425 1.9e-28
UNIPROTKB|F1RR73157 NUDCD2 "Uncharacterized protei 0.888 0.910 0.425 1.9e-28
RGD|1307203157 Nudcd2 "NudC domain containing 0.888 0.910 0.425 1.9e-28
UNIPROTKB|E2RSY6192 NUDCD2 "Uncharacterized protei 0.888 0.744 0.425 2.4e-28
MGI|MGI:1277103157 Nudcd2 "NudC domain containing 0.888 0.910 0.425 2.4e-28
ZFIN|ZDB-GENE-040801-49157 nudcd2 "NudC domain containing 0.863 0.885 0.381 3.3e-24
TAIR|locus:2178888158 AT5G58740 "AT5G58740" [Arabido 0.751 0.765 0.370 1.5e-10
TAIR|locus:2137345293 AT4G27890 "AT4G27890" [Arabido 0.459 0.252 0.236 2.1e-06
UNIPROTKB|E1BUG9 NUDCD2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 326 (119.8 bits), Expect = 2.1e-29, P = 2.1e-29
 Identities = 65/148 (43%), Positives = 92/148 (62%)

Query:     7 FDEKGGVVKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQG 66
             F+E+ GVV C TPWG W+QTL+EVFIEV +    R++D+     +  ++ ++ G+E+ QG
Sbjct:     5 FEERSGVVPCVTPWGRWYQTLEEVFIEVQVPPGTRAKDVCCSLQSRRVALSVCGREVLQG 64

Query:    67 KLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMK 126
             KL D    DE  WTLE+   L+ IVL K   +     W SL  N    YA DP +  +M+
Sbjct:    65 KLFDSTIADEGTWTLEDR-KLIRIVLMKTN-RDAGNCWTSLLENE---YAADPWVQDQMQ 119

Query:   127 KKMDLEKFQIENPGFDFSRAKLAKCYDK 154
             +K+ LE+FQ ENPGFDFS A+++  Y K
Sbjct:   120 RKLTLERFQRENPGFDFSGAEISGNYSK 147
GO:0005622 "intracellular" evidence=IEA
UNIPROTKB|Q32KU8 NUDCD2 "NudC domain containing 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WVJ2 NUDCD2 "NudC domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RR73 NUDCD2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1307203 Nudcd2 "NudC domain containing 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSY6 NUDCD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1277103 Nudcd2 "NudC domain containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-49 nudcd2 "NudC domain containing 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2178888 AT5G58740 "AT5G58740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137345 AT4G27890 "AT4G27890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5M823NUDC2_RATNo assigned EC number0.42560.88810.9108yesN/A
Q9CQ48NUDC2_MOUSENo assigned EC number0.42560.88810.9108yesN/A
Q8WVJ2NUDC2_HUMANNo assigned EC number0.42560.88810.9108yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
cd0649493 cd06494, p23_NUDCD2_like, p23-like NUD (nuclear di 1e-21
cd0646785 cd06467, p23_NUDC_like, p23_like domain of NUD (nu 5e-15
cd0646384 cd06463, p23_like, Proteins containing this p23_li 8e-08
pfam0496978 pfam04969, CS, CS domain 1e-07
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 4e-04
>gnl|CDD|107243 cd06494, p23_NUDCD2_like, p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information 
 Score = 83.3 bits (206), Expect = 1e-21
 Identities = 42/94 (44%), Positives = 58/94 (61%), Gaps = 2/94 (2%)

Query: 14  VKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQGKLLDVVH 73
           V C TPWG W+QT+DEVFIEV +    R++D+  K  + +IS  + G+E+ +GKL D V 
Sbjct: 1   VPCKTPWGCWYQTMDEVFIEVNVPPGTRAKDVKCKLGSRDISLAVKGQEVLKGKLFDSVV 60

Query: 74  GDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSL 107
            DE  WTLE+   L+ IVL K+  +     W SL
Sbjct: 61  ADECTWTLEDR-KLIRIVLTKSN-RDAGNCWKSL 92

Little is known about the function of the proteins in this subgroup. Length = 93
>gnl|CDD|107224 cd06467, p23_NUDC_like, p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>gnl|CDD|107220 cd06463, p23_like, Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>gnl|CDD|218355 pfam04969, CS, CS domain Back     alignment and domain information
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 161
KOG2265|consensus179 100.0
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 99.96
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 99.96
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 99.94
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 99.91
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 99.86
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 99.8
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 99.74
cd0646892 p23_CacyBP p23_like domain found in proteins simil 99.74
cd0646384 p23_like Proteins containing this p23_like domain 99.68
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 99.67
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.66
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 99.6
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 99.6
cd0648887 p23_melusin_like p23_like domain similar to the C- 99.58
KOG4379|consensus 596 99.33
KOG1309|consensus196 99.28
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.23
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 99.16
KOG3158|consensus180 99.09
cd0029880 ACD_sHsps_p23-like This domain family includes the 98.92
KOG3260|consensus224 98.53
KOG1667|consensus320 98.3
COG0071146 IbpA Molecular chaperone (small heat shock protein 97.54
COG5091368 SGT1 Suppressor of G2 allele of skp1 and related p 97.52
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 97.27
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 97.24
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 96.96
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 96.74
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 96.72
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 96.2
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 96.16
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 95.83
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 95.78
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 95.78
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 95.64
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 95.58
PRK10743137 heat shock protein IbpA; Provisional 95.48
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 95.25
PRK11597142 heat shock chaperone IbpB; Provisional 94.44
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 93.71
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 93.48
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 92.15
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 90.92
KOG2265|consensus179 87.16
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 85.49
>KOG2265|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.2e-38  Score=244.30  Aligned_cols=136  Identities=29%  Similarity=0.437  Sum_probs=126.0

Q ss_pred             Ccc-cCCccccCCCCeEEEeeCCEEEEEEEcCCCC-CccceEEEEecCEEEEEeCCee-eeeccccCceecCccEEEEec
Q psy11204          7 FDE-KGGVVKCPTPWGSWWQTLDEVFIEVILTDKV-RSRDIAIKCTNTEISCTIAGKE-LFQGKLLDVVHGDEIIWTLEN   83 (161)
Q Consensus         7 ~~~-~~~~~~~~~~~Y~W~Qt~~eV~I~I~lp~~~-~~kdv~V~i~~~~L~V~vkg~~-~i~g~L~~~V~~deStW~i~d   83 (161)
                      ++| +.+.+.|..+.|+|+||+.+|+|.|+||+++ ++++|.|.|..+||+|+++|++ +++|+|++.|++|+|+|+|++
T Consensus         6 ~eE~p~~~ng~~~~~y~W~QtL~EV~i~i~vp~~~~ksk~v~~~Iq~~hI~V~~kg~~~ildG~L~~~vk~des~WtiEd   85 (179)
T KOG2265|consen    6 KEEKPNSGNGADEEKYTWDQTLEEVEIQIPVPPGTAKSKDVHCSIQSKHIKVGLKGQPPILDGELSHSVKVDESTWTIED   85 (179)
T ss_pred             cccCCcccCCccccceeeeeehhheEEEeecCCCCcccceEEEEeeeeEEEEecCCCCceecCccccccccccceEEecC
Confidence            355 8899999999999999999999999999999 9999999999999999999997 999999999999999999999


Q ss_pred             CCeEEEEEEEeccCcccccccccceeccccCCCCCc-----------------------------------cchHHHHHH
Q psy11204         84 NGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDP-----------------------------------TIFHEMKKK  128 (161)
Q Consensus        84 ~~~~l~I~L~K~~~~~~~~~W~~L~~~~~G~~~iD~-----------------------------------~~~de~~~~  128 (161)
                      ++ .+.|.|.|.+++   .||.+|++   |+++||+                                   +++||.+++
T Consensus        86 ~k-~i~i~l~K~~~~---eWW~~ll~---gep~ID~~ki~~e~skl~dldeEtra~vekmmfdq~qk~~~~p~sde~~~~  158 (179)
T KOG2265|consen   86 GK-MIVILLKKSNKM---EWWDSLLE---GEPEIDTKKIEPEESKLSDLDEETRATVEKMMFDQRQKSMGLPTSDELKKH  158 (179)
T ss_pred             CE-EEEEEeeccchH---HHHHHHHc---CCCCCCccccChhhhhhhhccHHHHHhhhccchhHHHhhcCCCCCchhhHH
Confidence            87 889999999874   89999999   9999983                                   366777888


Q ss_pred             HHHHHHHHhCCCCCccCCccC
Q psy11204        129 MDLEKFQIENPGFDFSRAKLA  149 (161)
Q Consensus       129 ~~l~~~~~~~p~~Dfs~a~~~  149 (161)
                      ++|++|+.+||+||||+|.||
T Consensus       159 d~Lkk~~~~~~~~~f~~a~~~  179 (179)
T KOG2265|consen  159 DMLKKFMDQHPEMDFSNAKFN  179 (179)
T ss_pred             HHHHHHHHhCCCCCCchhccC
Confidence            999999999999999999986

>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>KOG4379|consensus Back     alignment and domain information
>KOG1309|consensus Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>KOG3158|consensus Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>KOG3260|consensus Back     alignment and domain information
>KOG1667|consensus Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5091 SGT1 Suppressor of G2 allele of skp1 and related proteins [General function prediction only] Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>KOG2265|consensus Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
2rh0_B157 Crystal Structure Of Nudc Domain-containing Protein 2e-28
>pdb|2RH0|B Chain B, Crystal Structure Of Nudc Domain-containing Protein 2 (13542905) From Mus Musculus At 1.95 A Resolution Length = 157 Back     alignment and structure 
Iteration: 1

 Score =  121 bits (304), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 90/148 (60%), Gaps = 5/148 (3%)
Query: 7   FDEKGGVVKCPTPWGSWWQTLDEVFIEVILTDKVRSRDIAIKCTNTEISCTIAGKELFQG 66
           F+E+ GVV C TPWG W+QTL+EVFIEV +    R++DI     +  ++  + G+E+ +G
Sbjct: 2   FEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALAVGGREILKG 61
Query: 67  KLLDVVHGDEIIWTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMK 126
           KL D    DE  WTLE+    + IVL K + +     W SL    +  YA DP +  + +
Sbjct: 62  KLFDSTIADEGTWTLEDR-KXVRIVLTKTK-RDAANCWTSLL---ESEYAADPWVQDQXQ 116
Query: 127 KKMDLEKFQIENPGFDFSRAKLAKCYDK 154
           +K+ LE+FQ ENPGFDFS A+++  Y K
Sbjct: 117 RKLTLERFQKENPGFDFSGAEISGNYTK 144

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 1e-37
2o30_A131 Nuclear movement protein; MCSG, structural genomic 5e-15
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 6e-14
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 4e-11
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 8e-10
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Length = 131 Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Length = 131 Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Length = 121 Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Length = 124 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 100.0
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 99.95
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 99.93
2o30_A131 Nuclear movement protein; MCSG, structural genomic 99.93
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 99.93
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 99.84
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 99.81
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 99.78
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 99.75
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 99.72
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 99.65
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 99.63
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 98.14
4fei_A102 Heat shock protein-related protein; stress respons 98.03
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 97.92
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 97.86
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 97.58
1gme_A151 Heat shock protein 16.9B; small heat shock protein 97.39
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 97.34
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 97.2
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 97.13
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 97.07
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 96.9
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 96.21
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 95.62
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 90.34
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 161
d1wfia_131 b.15.1.4 (A:) Nuclear migration protein nudC {Mous 5e-12
d1wgva_124 b.15.1.4 (A:) NudC domain containing protein 3, NU 7e-09
d1rl1a_92 b.15.1.3 (A:) Suppressor of G2 allele of skp1 homo 2e-06
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Length = 131 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: Nuclear movement domain
domain: Nuclear migration protein nudC
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 57.6 bits (139), Expect = 5e-12
 Identities = 22/112 (19%), Positives = 47/112 (41%), Gaps = 10/112 (8%)

Query: 22  SWWQTLDEVFIEVIL--TDKVRSRDIAIKCTNTEISCTIAGKE-LFQGKLLDVVHGDEII 78
            W QTL E+ + V    + +++ +D+ +      +   + G+  +  G+L + V  +E  
Sbjct: 11  RWTQTLAELDLAVPFRVSFRLKGKDVVVDIQRRHLRVGLKGQPPVVDGELYNEVKVEESS 70

Query: 79  WTLENNGTLLNIVLPKAEFKGKEQIWNSLFVNSKENYATDPTIFHEMKKKMD 130
           W +E+   +  + L K     K + WN L  +  E    +    +    K+ 
Sbjct: 71  WLIEDGKVVT-VHLEKIN---KMEWWNRLVTSDPEI---NTKKINPENSKLS 115
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 99.93
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 99.92
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 99.81
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 99.8
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 99.51
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 97.24
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 96.76
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: Nuclear movement domain
domain: Nuclear migration protein nudC
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.93  E-value=2e-26  Score=170.18  Aligned_cols=102  Identities=20%  Similarity=0.397  Sum_probs=92.4

Q ss_pred             CCCCeEEEeeCCEEEEEEEc--CCCCCccceEEEEecCEEEEEeCCee-eeeccccCceecCccEEEEecCCeEEEEEEE
Q psy11204         17 PTPWGSWWQTLDEVFIEVIL--TDKVRSRDIAIKCTNTEISCTIAGKE-LFQGKLLDVVHGDEIIWTLENNGTLLNIVLP   93 (161)
Q Consensus        17 ~~~~Y~W~Qt~~eV~I~I~l--p~~~~~kdv~V~i~~~~L~V~vkg~~-~i~g~L~~~V~~deStW~i~d~~~~l~I~L~   93 (161)
                      ..|+|+|+||.++|+|+|++  |.+++++||.|.|++++|+|.++|++ ++.|+||++|++++|+|+|++++ +|+|+|.
T Consensus         6 ~~~~Y~W~Qt~~eV~I~V~~~~~~~~~~~di~v~i~~~~l~v~v~~~~~ll~g~L~~~I~~des~W~ied~~-~l~i~L~   84 (131)
T d1wfia_           6 SGPNYRWTQTLAELDLAVPFRVSFRLKGKDVVVDIQRRHLRVGLKGQPPVVDGELYNEVKVEESSWLIEDGK-VVTVHLE   84 (131)
T ss_dssp             SCCSSEEEECSSEEEEEECCCCSSCCCTTSEEEEEETTEEEEEETTSCCSBCSCBSSCBCSTTCEEEEETTT-EEEEEEE
T ss_pred             CCCCeEEEeeCCEEEEEEEcCCCCCcchhhEEEEeeCCEEEEEEcCCceeecccccCcccccccEEEEeCCC-EEEEEEE
Confidence            57899999999999999866  56899999999999999999999975 99999999999999999999877 7799999


Q ss_pred             eccCcccccccccceeccccCCCCCccchHHH
Q psy11204         94 KAEFKGKEQIWNSLFVNSKENYATDPTIFHEM  125 (161)
Q Consensus        94 K~~~~~~~~~W~~L~~~~~G~~~iD~~~~de~  125 (161)
                      |+.+   +.||++||+   |+++||+...+++
T Consensus        85 K~~~---~~~W~~l~~---gd~~id~~~~~~~  110 (131)
T d1wfia_          85 KINK---MEWWNRLVT---SDPEINTKKINPE  110 (131)
T ss_dssp             BSSS---CCCCSCSBS---SCCSCCCSSSSCC
T ss_pred             ECCC---CccCHHHcC---CCCCCCHhHcCcc
Confidence            9886   479999999   9999998776644
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure