Diaphorina citri psyllid: psy11213


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-
MSFVLIPLITLHQSLFRWPLSFPVADRTTVSVPTLSSIFQLVIYFSEKFKEFLIEFVKIDKDDNKIFKYSEQLSKLAHREQVAIYIDLDDEFLIEFVKIDKDDNKIFKYSKQLSKLAHREQVAIYIDLDDVEEFNSDLATNIQNNTRRYVQMFSELIFELLPDYKSHDVIAKDPLDIYIEHRLLLEQRNHPNPQELRNSQNRYPQDLMRRFEVYFVPPSSGKPTPIREVKATHIGKLVNVRGVVTRSTEVKPLMTVATYTCDMCGAETYQPISSLSFTPLLMCPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHSDQVPVGNIPRGITVLCRGENTRQVVPGDHVSVSGIFLPLLRTGFRQVTQGNINICLMGDPGVAKSQLLSYIERLARRSQYTTGRGSSGVGLTAAVMKDPITNEMVLEGGALVLADQGICCIDEFDKLPDADRTAIHEVMEQQTISIAKAGIMTRLNARVSILAAANPAYGRYNPKRSIEQNIQLPAALLSRFDLLWLIQDKPDRDNDLKLAQHITYVHKHSRQPPTELKPIDMSLVRRYIDLCKGKNPTVPSSLTEHIVKAYTELRKVARNSRDMSYTSARNLLAILRLSTALARLRLCDEFQ
ccEEEHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccEEEEEcccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccHcccccccccccccCEEEEEEEccccccccccccccccccccEEEEEEEEEEccccccccEEEEEEccccccEEEEEcccccccccccccccccccccccccEEEEccccEEEccEEEEEEEccccccccccccccCEEEccccccccccccCEEEEEEccccccccccccccccEEEEEcccccHHHHHHHHHHHHHcccEEcccccccccccccEEEEEccccccEEEEccEEEECcccEEEECcccccccccHHHHHHHHcccHHHHHccHHHHHHHHHHHHHHHcccccccccccccHHHHcccccccccccEEEEEEEccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHccccccccc
*SFVLIPLITLHQSLFRWPLSFPVADRTTVSVPTLSSIFQLVIYFSEKFKEFLIEFVKIDKDDNKIFKYSEQLSKLAHREQVAIYIDLDDEFLIEFVKIDKDDNKIFKYSKQLSKLAHREQVAIYIDLDDVEEFNSDLATNIQNNTRRYVQMFSELIFELLPDYKSHDVIAKDPLDIYIEHR******************NRYPQDLMRRFEVYFVPPSSGKPTPIREVKATHIGKLVNVRGVVTRSTEVKPLMTVATYTCDMCGAETYQPISSLSFTPLLMCPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHSDQVPVGNIPRGITVLCRGENTRQVVPGDHVSVSGIFLPLLRTGFRQVTQGNINICLMGDPGVAKSQLLSYIERLARRSQYTTGRGSSGVGLTAAVMKDPITNEMVLEGGALVLADQGICCIDEFDKLPDADRTAIHEVMEQQTISIAKAGIMTRLNARVSILAAANPAYGRYNPKRSIEQNIQLPAALLSRFDLLWLIQDKPDRDNDLKLAQHITYVHK*********KPIDMSLVRRYIDLCKGKNPTVPSSLTEHIVKAYTELRKVARNSRDMSYTSARNLLAILRLSTALARLRLCDE**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFVLIPLITLHQSLFRWPLSFPVADRTTVSVPTLSSIFQLVIYFSEKFKEFLIEFVKIDKDDNKIFKYSEQLSKLAHREQVAIYIDLDDEFLIEFVKIDKDDNKIFKYSKQLSKLAHREQVAIYIDLDDVEEFNSDLATNIQNNTRRYVQMFSELIFELLPDYKSHDVIAKDPLDIYIEHRLLLEQRNHPNPQELRNSQNRYPQDLMRRFEVYFVPPSSGKPTPIREVKATHIGKLVNVRGVVTRSTEVKPLMTVATYTCDMCGAETYQPISSLSFTPLLMCPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHSDQVPVGNIPRGITVLCRGENTRQVVPGDHVSVSGIFLPLLRTGFRQVTQGNINICLMGDPGVAKSQLLSYIERLARRSQYTTGRGSSGVGLTAAVMKDPITNEMVLEGGALVLADQGICCIDEFDKLPDADRTAIHEVMEQQTISIAKAGIMTRLNARVSILAAANPAYGRYNPKRSIEQNIQLPAALLSRFDLLWLIQDKPDRDNDLKLAQHITYVHKHSRQPPTELKPIDMSLVRRYIDLCKGKNPTVPSSLTEHIVKAYTELRKVARNSRDMSYTSARNLLAILRLSTALARLRLCDEFQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA replication licensing factor MCM7 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for S-phase checkpoint activation upon UV-induced damage.confidentP33993
DNA replication licensing factor Mcm7 Acts as component of the Mcm2-7 complex (Mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the Mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.confidentQ9XYU0
DNA replication licensing factor MCM7 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for S-phase checkpoint activation upon UV-induced damage.confidentQ61881

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003678 [MF]DNA helicase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674, GO:0004386
GO:0042325 [BP]regulation of phosphorylationprobableGO:0019220, GO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0006270 [BP]DNA replication initiationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0042555 [CC]MCM complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0006974 [BP]response to DNA damage stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0008094 [MF]DNA-dependent ATPase activityprobableGO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003697 [MF]single-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0071364 [BP]cellular response to epidermal growth factor stimulusprobableGO:0071495, GO:0009719, GO:0051716, GO:0071363, GO:0050896, GO:0009987, GO:0070849, GO:0070848, GO:0044763, GO:0071310, GO:0008150, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0006268 [BP]DNA unwinding involved in replicationprobableGO:0071103, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0032392, GO:0006139, GO:0032508, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F9V, chain A
Confidence level:very confident
Coverage over the Query: 86-165,193-621
View the alignment between query and template
View the model in PyMOL