Psyllid ID: psy11213
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 621 | ||||||
| 427792767 | 634 | Putative dna replication licensing facto | 0.787 | 0.771 | 0.670 | 0.0 | |
| 328710700 | 724 | PREDICTED: DNA replication licensing fac | 0.404 | 0.346 | 0.845 | 1e-123 | |
| 195588887 | 607 | GD14135 [Drosophila simulans] gi|1941961 | 0.409 | 0.418 | 0.819 | 1e-123 | |
| 17647617 | 720 | minichromosome maintenance 7 [Drosophila | 0.409 | 0.352 | 0.819 | 1e-123 | |
| 194748867 | 721 | GF24361 [Drosophila ananassae] gi|190624 | 0.407 | 0.350 | 0.819 | 1e-123 | |
| 195491035 | 720 | GE20787 [Drosophila yakuba] gi|194179492 | 0.409 | 0.352 | 0.819 | 1e-123 | |
| 194865768 | 720 | GG14355 [Drosophila erecta] gi|190653377 | 0.409 | 0.352 | 0.819 | 1e-123 | |
| 195125904 | 720 | GI12937 [Drosophila mojavensis] gi|19391 | 0.409 | 0.352 | 0.819 | 1e-122 | |
| 125978096 | 720 | GA18569 [Drosophila pseudoobscura pseudo | 0.409 | 0.352 | 0.819 | 1e-122 | |
| 195428459 | 720 | GK16745 [Drosophila willistoni] gi|19415 | 0.409 | 0.352 | 0.811 | 1e-122 |
| >gi|427792767|gb|JAA61835.1| Putative dna replication licensing factor mcm4 component, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
Score = 746 bits (1926), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 360/537 (67%), Positives = 424/537 (78%), Gaps = 48/537 (8%)
Query: 129 DDVEEFNSDLATNIQNNTRRYVQMFSELIFELLPDYKSHDVIAKDPLDIYIEHRLLLEQR 188
DDVE+++S LA I N RRY +F+++++E+LPDYK +++AKD LD+YIEHR+L+E R
Sbjct: 1 DDVEDYDSGLAEAIMQNARRYSNLFADVVYEMLPDYKQKEILAKDALDVYIEHRMLMENR 60
Query: 189 NHPNPQELRNSQNRYPQDLMRRFEVYFVPPSSGKPTPIREVKATHIGKLVNVRGVVTRST 248
+ P ++R+ +N+YP +LMRR+EVYF PS+ KP +R+VKA IGKLV V+G+VTR T
Sbjct: 61 SR-QPGDVRDPRNKYPPELMRRYEVYFKMPSATKPLSVRDVKAGCIGKLVTVKGIVTRCT 119
Query: 249 EVKPLMTVATYTCDMCGAETYQPISSLSFTPLLMCPSEDCQVNKSGGRLYLQTRGSKFVK 308
EVKP+M VATYTCD CGAETYQPI+S SF PL+ CPS+DC+VN+SGGRLYLQTRGSKF+K
Sbjct: 120 EVKPIMCVATYTCDQCGAETYQPINSPSFMPLVTCPSDDCRVNRSGGRLYLQTRGSKFIK 179
Query: 309 FQELKVQEHSDQVPVGNIPRGITVLCRGENTRQVVPGDHVSVSGIFLPLLRTGFRQV--- 365
FQELK+QEHSDQVPVGNIPR +TV RGE TR +PGDHVSV+GIFLPLLRTGFRQ+
Sbjct: 180 FQELKIQEHSDQVPVGNIPRSMTVYVRGELTRSALPGDHVSVTGIFLPLLRTGFRQMQGG 239
Query: 366 -------------------------------------------TQGNINICLMGDPGVAK 382
+GNINICLMGDPGVAK
Sbjct: 240 LLSDTYLEAHRIVKMNKMEDDELDDSMMTPEELEALRHPNGMKIRGNINICLMGDPGVAK 299
Query: 383 SQLLSYIERLARRSQYTTGRGSSGVGLTAAVMKDPITNEMVLEGGALVLADQGICCIDEF 442
SQLLSYI+RLA RSQYTTGRGSSGVGLTA+VMKDP+T EM LEGGALVLAD+G+CCIDEF
Sbjct: 300 SQLLSYIDRLAPRSQYTTGRGSSGVGLTASVMKDPLTGEMTLEGGALVLADRGVCCIDEF 359
Query: 443 DKLPDADRTAIHEVMEQQTISIAKAGIMTRLNARVSILAAANPAYGRYNPKRSIEQNIQL 502
DK+ D+DRTAIHEVMEQQTISIAKAGIMT LNAR SILAAANPAYGRYNPKRSIEQN+QL
Sbjct: 360 DKMMDSDRTAIHEVMEQQTISIAKAGIMTTLNARTSILAAANPAYGRYNPKRSIEQNVQL 419
Query: 503 PAALLSRFDLLWLIQDKPDRDNDLKLAQHITYVHKHSRQPPTEL-KPIDMSLVRRYIDLC 561
PAALLSRFDLLWLIQDKPDR+NDL+LA HIT+VHK+ +PP KP+DM L+RRYI LC
Sbjct: 420 PAALLSRFDLLWLIQDKPDRENDLRLANHITFVHKNCSEPPQGTHKPLDMRLMRRYIALC 479
Query: 562 KGKNPTVPSSLTEHIVKAYTELRKVARNSRDMSYTSARNLLAILRLSTALARLRLCD 618
K K P VP LT++IV AY E+RK ARNS+D ++ S R LLAILRLSTALARLRL +
Sbjct: 480 KSKQPVVPEELTDYIVSAYVEMRKEARNSKDATFMSPRTLLAILRLSTALARLRLVE 536
|
Source: Rhipicephalus pulchellus Species: Rhipicephalus pulchellus Genus: Rhipicephalus Family: Ixodidae Order: Ixodida Class: Arachnida Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328710700|ref|XP_001952343.2| PREDICTED: DNA replication licensing factor mcm7-like isoform 1 [Acyrthosiphon pisum] gi|328710702|ref|XP_003244337.1| PREDICTED: DNA replication licensing factor mcm7-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|195588887|ref|XP_002084188.1| GD14135 [Drosophila simulans] gi|194196197|gb|EDX09773.1| GD14135 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|17647617|ref|NP_523984.1| minichromosome maintenance 7 [Drosophila melanogaster] gi|75029476|sp|Q9XYU0.1|MCM7_DROME RecName: Full=DNA replication licensing factor Mcm7; AltName: Full=Minichromosome maintenance 7 protein; Short=DmMCM3 gi|4903288|gb|AAD32857.1|AF124743_1 DNA replication factor MCM7 [Drosophila melanogaster] gi|7295030|gb|AAF50357.1| minichromosome maintenance 7 [Drosophila melanogaster] gi|25012341|gb|AAN71281.1| RE04406p [Drosophila melanogaster] gi|220949456|gb|ACL87271.1| Mcm7-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|194748867|ref|XP_001956863.1| GF24361 [Drosophila ananassae] gi|190624145|gb|EDV39669.1| GF24361 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195491035|ref|XP_002093391.1| GE20787 [Drosophila yakuba] gi|194179492|gb|EDW93103.1| GE20787 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|194865768|ref|XP_001971594.1| GG14355 [Drosophila erecta] gi|190653377|gb|EDV50620.1| GG14355 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195125904|ref|XP_002007414.1| GI12937 [Drosophila mojavensis] gi|193919023|gb|EDW17890.1| GI12937 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|125978096|ref|XP_001353081.1| GA18569 [Drosophila pseudoobscura pseudoobscura] gi|54641832|gb|EAL30582.1| GA18569 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195428459|ref|XP_002062290.1| GK16745 [Drosophila willistoni] gi|194158375|gb|EDW73276.1| GK16745 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 621 | ||||||
| FB|FBgn0020633 | 720 | Mcm7 "Minichromosome maintenan | 0.376 | 0.325 | 0.824 | 1.5e-203 | |
| UNIPROTKB|Q91876 | 720 | mcm7-a "DNA replication licens | 0.375 | 0.323 | 0.793 | 2.1e-202 | |
| UNIPROTKB|Q6NX31 | 720 | mcm7 "DNA replication licensin | 0.375 | 0.323 | 0.802 | 1.9e-201 | |
| UNIPROTKB|Q7ZXB1 | 720 | mcm7-b "DNA replication licens | 0.375 | 0.323 | 0.798 | 1.3e-200 | |
| UNIPROTKB|E2RNU4 | 719 | MCM7 "Uncharacterized protein" | 0.375 | 0.324 | 0.785 | 4.1e-199 | |
| UNIPROTKB|Q3ZBH9 | 719 | MCM7 "DNA replication licensin | 0.375 | 0.324 | 0.781 | 2.2e-198 | |
| UNIPROTKB|P33993 | 719 | MCM7 "DNA replication licensin | 0.375 | 0.324 | 0.781 | 3.6e-198 | |
| ZFIN|ZDB-GENE-020419-27 | 721 | mcm7 "MCM7 minichromosome main | 0.407 | 0.350 | 0.751 | 4.6e-198 | |
| RGD|1303018 | 719 | Mcm7 "minichromosome maintenan | 0.407 | 0.351 | 0.736 | 7.5e-198 | |
| MGI|MGI:1298398 | 719 | Mcm7 "minichromosome maintenan | 0.407 | 0.351 | 0.732 | 1.1e-196 |
| FB|FBgn0020633 Mcm7 "Minichromosome maintenance 7" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1026 (366.2 bits), Expect = 1.5e-203, Sum P(2) = 1.5e-203
Identities = 193/234 (82%), Positives = 216/234 (92%)
Query: 367 QGNINICLMGDPGVAKSQLLSYIERLARRSQYTTGRGSSGVGLTAAVMKDPITNEMVLEG 426
+GNINICLMGDPGVAKSQLL YI RLA RSQYTTGRGSSGVGLTAAVMKDP+T EM LEG
Sbjct: 372 RGNINICLMGDPGVAKSQLLGYISRLAVRSQYTTGRGSSGVGLTAAVMKDPLTGEMTLEG 431
Query: 427 GALVLADQGICCIDEFDKLPDADRTAIHEVMEQQTISIAKAGIMTRLNARVSILAAANPA 486
GALVLADQG+CCIDEFDK+ D DRTAIHEVMEQQTISIAKAGIMT LNARVSILAAANPA
Sbjct: 432 GALVLADQGVCCIDEFDKMADQDRTAIHEVMEQQTISIAKAGIMTTLNARVSILAAANPA 491
Query: 487 YGRYNPKRSIEQNIQLPAALLSRFDLLWLIQDKPDRDNDLKLAQHITYVHKHSRQPPTEL 546
+GRYNP+R++EQNIQLPAALLSRFDLLWLIQDKPDRDNDL+LA+HITYVH HS+QPPT +
Sbjct: 492 FGRYNPRRTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAKHITYVHSHSKQPPTRV 551
Query: 547 KPIDMSLVRRYIDLCKGKNPTVPSSLTEHIVKAYTELRKVARNSRDMSYTSARN 600
K +DM+L+RRYI+LCK KNPT+P LT++IV AY ELR+ ARN +DM++TSARN
Sbjct: 552 KALDMNLMRRYINLCKRKNPTIPDELTDYIVGAYVELRREARNQKDMTFTSARN 605
|
|
| UNIPROTKB|Q91876 mcm7-a "DNA replication licensing factor mcm7-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6NX31 mcm7 "DNA replication licensing factor mcm7" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7ZXB1 mcm7-b "DNA replication licensing factor mcm7-B" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RNU4 MCM7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZBH9 MCM7 "DNA replication licensing factor MCM7" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P33993 MCM7 "DNA replication licensing factor MCM7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-020419-27 mcm7 "MCM7 minichromosome maintenance deficient 7 (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1303018 Mcm7 "minichromosome maintenance complex component 7" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1298398 Mcm7 "minichromosome maintenance deficient 7 (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 621 | |||
| smart00350 | 509 | smart00350, MCM, minichromosome maintenance protei | 1e-136 | |
| pfam00493 | 327 | pfam00493, MCM, MCM2/3/5 family | 1e-136 | |
| COG1241 | 682 | COG1241, MCM2, Predicted ATPase involved in replic | 1e-104 | |
| PTZ00111 | 915 | PTZ00111, PTZ00111, DNA replication licensing fact | 5e-57 | |
| smart00350 | 509 | smart00350, MCM, minichromosome maintenance protei | 4e-47 | |
| COG1241 | 682 | COG1241, MCM2, Predicted ATPase involved in replic | 3e-41 | |
| COG0714 | 329 | COG0714, COG0714, MoxR-like ATPases [General funct | 7e-10 | |
| pfam07728 | 135 | pfam07728, AAA_5, AAA domain (dynein-related subfa | 4e-08 | |
| COG1239 | 423 | COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme | 5e-04 |
| >gnl|CDD|214631 smart00350, MCM, minichromosome maintenance proteins | Back alignment and domain information |
|---|
Score = 407 bits (1049), Expect = e-136
Identities = 140/257 (54%), Positives = 179/257 (69%), Gaps = 5/257 (1%)
Query: 368 GNINICLMGDPGVAKSQLLSYIERLARRSQYTTGRGSSGVGLTAAVMKDPITNEMVLEGG 427
G+INI L GDPG AKSQLL Y+E+ A R+ YTTG+GSS VGLTAAV +DP T E LE G
Sbjct: 235 GDINILLCGDPGTAKSQLLKYVEKTAPRAVYTTGKGSSAVGLTAAVTRDPETREFTLEAG 294
Query: 428 ALVLADQGICCIDEFDKLPDADRTAIHEVMEQQTISIAKAGIMTRLNARVSILAAANPAY 487
ALVLAD G+CCIDEFDK+ D+DRTAIHE MEQQTISIAKAGI T LNAR S+LAAANP
Sbjct: 295 ALVLADNGVCCIDEFDKMDDSDRTAIHEAMEQQTISIAKAGITTTLNARCSVLAAANPIG 354
Query: 488 GRYNPKRSIEQNIQLPAALLSRFDLLWLIQDKPDRDNDLKLAQHITYVHKHSRQPPTEL- 546
GRY+PK + E+NI LPA +LSRFDLL+++ D+ D + D +LA+H+ +H++S E
Sbjct: 355 GRYDPKLTPEENIDLPAPILSRFDLLFVVLDEVDEERDRELAKHVVDLHRYSHPEEDEAF 414
Query: 547 -KPIDMSLVRRYIDLCKGK-NPTVPSSLTEHIVKAYTELRKVARNSRDMS--YTSARNLL 602
P+ +R+YI + K P + + +VKAY +LRK + S + R L
Sbjct: 415 EPPLSQEKLRKYIAYAREKIKPKLSEEAADKLVKAYVDLRKEDSQTESRSSIPITVRQLE 474
Query: 603 AILRLSTALARLRLCDE 619
+I+RLS A A++RL D
Sbjct: 475 SIIRLSEAHAKMRLSDV 491
|
Length = 509 |
| >gnl|CDD|215947 pfam00493, MCM, MCM2/3/5 family | Back alignment and domain information |
|---|
| >gnl|CDD|224162 COG1241, MCM2, Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|173403 PTZ00111, PTZ00111, DNA replication licensing factor MCM4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214631 smart00350, MCM, minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >gnl|CDD|224162 COG1241, MCM2, Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) | Back alignment and domain information |
|---|
| >gnl|CDD|224160 COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 621 | |||
| KOG0482|consensus | 721 | 100.0 | ||
| KOG0480|consensus | 764 | 100.0 | ||
| KOG0477|consensus | 854 | 100.0 | ||
| COG1241 | 682 | MCM2 Predicted ATPase involved in replication cont | 100.0 | |
| KOG0478|consensus | 804 | 100.0 | ||
| KOG0481|consensus | 729 | 100.0 | ||
| KOG0479|consensus | 818 | 100.0 | ||
| PTZ00111 | 915 | DNA replication licensing factor MCM4; Provisional | 100.0 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 100.0 | |
| PF00493 | 331 | MCM: MCM2/3/5 family This family extends the MCM d | 100.0 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 99.93 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 99.92 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 99.92 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 99.91 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 99.91 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 99.9 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 99.9 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 99.88 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 99.87 | |
| COG1239 | 423 | ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis | 99.87 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 99.86 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 99.86 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 99.85 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 99.83 | |
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 99.83 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 99.8 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 99.69 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 99.67 | |
| PHA02244 | 383 | ATPase-like protein | 99.66 | |
| PF14551 | 121 | MCM_N: MCM N-terminal domain; PDB: 2VL6_C 3F9V_A 1 | 99.65 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 99.64 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 99.56 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 99.5 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 99.48 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 99.45 | |
| COG3604 | 550 | FhlA Transcriptional regulator containing GAF, AAA | 99.44 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 99.42 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 99.4 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 99.4 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 99.39 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 99.38 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 99.37 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 99.34 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 99.33 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 99.33 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 99.3 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 99.29 | |
| COG1221 | 403 | PspF Transcriptional regulators containing an AAA- | 99.28 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 99.28 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 99.24 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 99.23 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 99.23 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 99.22 | |
| KOG0737|consensus | 386 | 99.2 | ||
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 99.2 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 99.19 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 99.18 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 99.16 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.15 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 99.14 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 99.11 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 99.11 | |
| KOG2004|consensus | 906 | 99.11 | ||
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 99.11 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 99.11 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 99.1 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 99.09 | |
| KOG0734|consensus | 752 | 99.09 | ||
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 99.08 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.08 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 99.07 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 99.07 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 99.04 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 99.04 | |
| KOG0738|consensus | 491 | 99.01 | ||
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 99.0 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 98.99 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 98.99 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 98.98 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 98.97 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 98.95 | |
| KOG2028|consensus | 554 | 98.95 | ||
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 98.94 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 98.93 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 98.91 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 98.91 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 98.91 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 98.91 | |
| KOG0745|consensus | 564 | 98.91 | ||
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 98.91 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 98.91 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 98.9 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 98.89 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 98.87 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 98.87 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 98.87 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 98.86 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 98.86 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 98.85 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 98.85 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 98.85 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 98.85 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 98.84 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 98.84 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 98.84 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 98.83 | |
| COG3283 | 511 | TyrR Transcriptional regulator of aromatic amino a | 98.82 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 98.81 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 98.79 | |
| KOG0736|consensus | 953 | 98.79 | ||
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 98.78 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 98.78 | |
| KOG0730|consensus | 693 | 98.77 | ||
| COG3284 | 606 | AcoR Transcriptional activator of acetoin/glycerol | 98.76 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 98.74 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 98.74 | |
| KOG0733|consensus | 802 | 98.73 | ||
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 98.73 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 98.72 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 98.71 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 98.7 | |
| KOG0733|consensus | 802 | 98.69 | ||
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 98.68 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 98.65 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 98.65 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 98.64 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 98.64 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 98.63 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 98.63 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 98.62 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 98.62 | |
| PRK06620 | 214 | hypothetical protein; Validated | 98.61 | |
| KOG0652|consensus | 424 | 98.6 | ||
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 98.59 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 98.58 | |
| KOG0731|consensus | 774 | 98.57 | ||
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 98.57 | |
| KOG0727|consensus | 408 | 98.55 | ||
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 98.55 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 98.55 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 98.54 | |
| KOG0740|consensus | 428 | 98.54 | ||
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 98.53 | |
| KOG0989|consensus | 346 | 98.51 | ||
| KOG0739|consensus | 439 | 98.51 | ||
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 98.5 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 98.49 | |
| KOG0742|consensus | 630 | 98.49 | ||
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 98.49 | |
| COG1067 | 647 | LonB Predicted ATP-dependent protease [Posttransla | 98.48 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.47 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 98.46 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 98.46 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 98.46 | |
| PRK08727 | 233 | hypothetical protein; Validated | 98.44 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 98.43 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 98.42 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 98.41 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 98.41 | |
| KOG0743|consensus | 457 | 98.41 | ||
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 98.4 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 98.39 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 98.39 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 98.38 | |
| PRK09087 | 226 | hypothetical protein; Validated | 98.38 | |
| PHA01747 | 425 | putative ATP-dependent protease | 98.38 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 98.37 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 98.36 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 98.34 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 98.32 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 98.31 | |
| KOG0726|consensus | 440 | 98.31 | ||
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 98.3 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 98.3 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 98.29 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 98.29 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 98.29 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 98.29 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 98.29 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 98.29 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 98.27 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 98.27 | |
| COG1220 | 444 | HslU ATP-dependent protease HslVU (ClpYQ), ATPase | 98.26 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 98.26 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 98.25 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 98.25 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 98.25 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 98.23 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 98.23 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 98.21 | |
| KOG0744|consensus | 423 | 98.19 | ||
| KOG0728|consensus | 404 | 98.18 | ||
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 98.18 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 98.17 | |
| KOG0735|consensus | 952 | 98.16 | ||
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 98.16 | |
| KOG0991|consensus | 333 | 98.16 | ||
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 98.12 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 98.12 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 98.12 | |
| KOG1808|consensus | 1856 | 98.12 | ||
| KOG0651|consensus | 388 | 98.11 | ||
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 98.1 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 98.09 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 98.09 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 98.08 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 98.07 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 98.06 | |
| COG4650 | 531 | RtcR Sigma54-dependent transcription regulator con | 98.04 | |
| PF13337 | 457 | Lon_2: Putative ATP-dependent Lon protease | 97.95 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 97.89 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 97.88 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 97.88 | |
| KOG0730|consensus | 693 | 97.88 | ||
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 97.87 | |
| KOG1051|consensus | 898 | 97.85 | ||
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 97.84 | |
| KOG0741|consensus | 744 | 97.79 | ||
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 97.72 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 97.71 | |
| PF08298 | 358 | AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi | 97.71 | |
| COG5245 | 3164 | DYN1 Dynein, heavy chain [Cytoskeleton] | 97.71 | |
| KOG0729|consensus | 435 | 97.71 | ||
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 97.69 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 97.69 | |
| PRK06526 | 254 | transposase; Provisional | 97.63 | |
| PRK08181 | 269 | transposase; Validated | 97.6 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 97.57 | |
| PRK12377 | 248 | putative replication protein; Provisional | 97.56 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 97.56 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 97.52 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 97.51 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 97.5 | |
| KOG1942|consensus | 456 | 97.5 | ||
| KOG0990|consensus | 360 | 97.49 | ||
| KOG0732|consensus | 1080 | 97.46 | ||
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 97.43 | |
| KOG2035|consensus | 351 | 97.37 | ||
| PRK08116 | 268 | hypothetical protein; Validated | 97.36 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 97.36 | |
| TIGR02653 | 675 | Lon_rel_chp conserved hypothetical protein. This m | 97.35 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 97.33 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 97.3 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 97.26 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 97.24 | |
| KOG0736|consensus | 953 | 97.23 | ||
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 97.22 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 97.19 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 97.19 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 97.14 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 97.12 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 97.11 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 96.95 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 96.91 | |
| PF05272 | 198 | VirE: Virulence-associated protein E; InterPro: IP | 96.84 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 96.81 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 96.81 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 96.78 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 96.77 | |
| PHA02774 | 613 | E1; Provisional | 96.74 | |
| KOG1969|consensus | 877 | 96.61 | ||
| KOG2680|consensus | 454 | 96.57 | ||
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 96.57 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.55 | |
| TIGR01613 | 304 | primase_Cterm phage/plasmid primase, P4 family, C- | 96.51 | |
| PHA02624 | 647 | large T antigen; Provisional | 96.27 | |
| PRK13695 | 174 | putative NTPase; Provisional | 96.25 | |
| KOG0735|consensus | 952 | 96.19 | ||
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 96.07 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.02 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 96.01 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 96.01 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 95.97 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 95.95 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 95.92 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 95.92 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 95.86 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 95.83 | |
| PF13173 | 128 | AAA_14: AAA domain | 95.71 | |
| PF13654 | 509 | AAA_32: AAA domain; PDB: 3K1J_B. | 95.71 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 95.64 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 95.6 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 95.58 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 95.56 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 95.54 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 95.54 | |
| PRK03839 | 180 | putative kinase; Provisional | 95.53 | |
| KOG3347|consensus | 176 | 95.52 | ||
| PRK08118 | 167 | topology modulation protein; Reviewed | 95.52 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 95.5 | |
| PRK05818 | 261 | DNA polymerase III subunit delta'; Validated | 95.42 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 95.4 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 95.37 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 95.35 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 95.32 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.29 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 95.18 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 95.16 | |
| PF13148 | 378 | DUF3987: Protein of unknown function (DUF3987) | 95.15 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 95.11 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 95.1 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 94.99 | |
| KOG1514|consensus | 767 | 94.89 | ||
| PRK06217 | 183 | hypothetical protein; Validated | 94.87 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 94.86 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.86 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 94.86 | |
| KOG1970|consensus | 634 | 94.84 | ||
| KOG3595|consensus | 1395 | 94.83 | ||
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 94.81 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 94.8 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 94.78 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 94.77 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 94.76 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 94.75 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 94.66 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 94.65 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 94.61 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 94.61 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 94.59 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 94.57 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 94.57 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 94.57 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 94.56 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 94.52 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 94.5 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 94.45 | |
| COG4930 | 683 | Predicted ATP-dependent Lon-type protease [Posttra | 94.38 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 94.29 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 94.28 | |
| PLN02200 | 234 | adenylate kinase family protein | 94.27 | |
| PTZ00202 | 550 | tuzin; Provisional | 94.21 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 94.21 | |
| PF05729 | 166 | NACHT: NACHT domain | 94.19 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 94.16 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 94.14 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 94.14 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 94.1 | |
| PF00519 | 432 | PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 | 94.1 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 94.09 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 94.04 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 94.04 | |
| PRK06581 | 263 | DNA polymerase III subunit delta'; Validated | 94.01 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 93.96 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 93.96 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 93.92 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 93.85 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 93.85 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 93.83 | |
| PF01057 | 271 | Parvo_NS1: Parvovirus non-structural protein NS1; | 93.83 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 93.83 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 93.82 | |
| PRK07276 | 290 | DNA polymerase III subunit delta'; Validated | 93.72 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 93.71 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 93.68 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 93.65 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 93.59 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 93.54 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 93.51 | |
| KOG2545|consensus | 543 | 93.49 | ||
| PLN02459 | 261 | probable adenylate kinase | 93.49 | |
| PLN02674 | 244 | adenylate kinase | 93.46 | |
| KOG0482|consensus | 721 | 93.46 | ||
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 93.41 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 93.28 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 93.18 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 93.18 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 93.16 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 93.13 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 93.13 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 93.09 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 93.06 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 92.98 | |
| KOG0064|consensus | 728 | 92.98 | ||
| PF12780 | 268 | AAA_8: P-loop containing dynein motor region D4; I | 92.96 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 92.93 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 92.9 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 92.89 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 92.87 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 92.87 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 92.87 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 92.83 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 92.81 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 92.8 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 92.77 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 92.76 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 92.74 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 92.74 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 92.72 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 92.69 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 92.68 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 92.67 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 92.66 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 92.65 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 92.55 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 92.55 | |
| PF13479 | 213 | AAA_24: AAA domain | 92.47 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 92.46 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 92.44 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 92.4 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 92.38 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 92.37 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 92.35 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 92.33 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 92.33 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 92.32 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 92.3 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 92.28 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 92.28 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 92.22 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 92.21 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 92.21 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 92.2 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 92.2 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 92.19 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 92.17 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 92.14 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 92.13 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 92.11 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 92.1 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 92.09 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 92.08 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 92.03 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 91.97 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 91.93 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 91.92 | |
| KOG2170|consensus | 344 | 91.83 | ||
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 91.8 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 91.79 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 91.76 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 91.75 | |
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 91.72 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 91.7 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 91.68 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 91.66 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 91.66 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 91.65 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 91.64 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 91.64 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 91.63 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 91.63 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 91.62 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 91.62 | |
| PRK08485 | 206 | DNA polymerase III subunit delta'; Validated | 91.59 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 91.58 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 91.58 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 91.57 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 91.56 | |
| cd04117 | 161 | Rab15 Rab15 subfamily. Rab15 colocalizes with the | 91.56 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 91.55 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 91.55 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 91.54 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 91.53 | |
| PLN02199 | 303 | shikimate kinase | 91.51 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 91.51 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 91.51 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 91.51 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 91.46 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 91.43 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 91.41 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 91.41 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 91.4 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 91.37 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 91.36 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 91.36 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 91.35 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 91.35 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 91.31 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 91.29 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 91.29 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 91.29 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 91.29 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 91.27 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 91.23 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 91.21 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 91.2 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 91.19 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 91.19 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 91.16 | |
| KOG0060|consensus | 659 | 91.14 | ||
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 91.14 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 91.12 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 91.12 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 91.11 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 91.1 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 91.08 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 91.08 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 91.05 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 91.04 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 91.04 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 91.03 | |
| cd04140 | 165 | ARHI_like ARHI subfamily. ARHI (A Ras homolog memb | 91.03 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 91.02 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 91.01 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 90.99 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 90.97 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 90.96 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 90.96 | |
| KOG0058|consensus | 716 | 90.96 | ||
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 90.95 |
| >KOG0482|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-121 Score=948.93 Aligned_cols=528 Identities=65% Similarity=1.047 Sum_probs=500.2
Q ss_pred hhHHHHHHhcccccccCcchhchHHHHHHHHHcCCcEEEEechhhhcccH--HHHHHHHHcHHHHHHHHHHHHHHhcCCC
Q psy11213 87 DLDDEFLIEFVKIDKDDNKIFKYSKQLSKLAHREQVAIYIDLDDVEEFNS--DLATNIQNNTRRYVQMFSELIFELLPDY 164 (621)
Q Consensus 87 ~~~~~Fl~~F~~~~~~~~~~~~Y~~~i~~~~~~~~~~l~Vd~~dL~~fd~--~La~~i~~np~~~l~l~~~av~el~~~~ 164 (621)
+.+++||.+|..+++.| +|+++|+++++++..+++||++||.+|+. +|..+|.+|..+|.++|.+++++++|.+
T Consensus 15 ~~~~~fl~e~~e~~~~~----kY~~~L~eia~Re~~ai~vdldDi~~~d~~~~l~~~i~~Na~ry~~lf~~~vdellp~~ 90 (721)
T KOG0482|consen 15 NKIKKFLDEFYEDNELG----KYMNQLQEIANREQNAIEVDLDDIAEYDDATELVGAIESNARRYVELFSDAVDELLPEP 90 (721)
T ss_pred HHHHHHHHhhhccCchh----HHHHHHHHHhcccceeEEEehHHHhhcchHHHHHHHHHHHHHHHHHHHHHHHHHhcCCc
Confidence 44588888887654433 89999999999999999999999999985 7999999999999999999999999998
Q ss_pred cccccccCChhhHHHHHHHHHhhhCCCCcccccccccCCcccccceeEEEEeCCCCCCCcccccccccCCCcEEEEEEEE
Q psy11213 165 KSHDVIAKDPLDIYIEHRLLLEQRNHPNPQELRNSQNRYPQDLMRRFEVYFVPPSSGKPTPIREVKATHIGKLVNVRGVV 244 (621)
Q Consensus 165 ~~~~~~~~d~ld~~~~~~~~~e~~~~~~~~~~~~~~~~~p~~l~~~~~v~~~~~~~~~~~~ir~l~s~~igkLV~i~GiV 244 (621)
.......+|++|+++.|+...+.. .+|. ..++.+.+|++|+++|+++|+|++..++..+|+++++|||+||+++|||
T Consensus 91 ~~~~~~~~d~lDv~~~qR~~~~~~--~~p~-~~~~~~~fP~~l~rryelyfk~~~~~kp~svR~vka~~iG~LvtvrGIV 167 (721)
T KOG0482|consen 91 TGEIPYGDDVLDVYMEQRLMRNET--RDPE-LEDKREQFPSELLRRYELYFKPLSNNKPYSVREVKADHIGSLVTVRGIV 167 (721)
T ss_pred ccccccCccHHHHHHHHHHHhccc--cCcc-ccchhhcCCHHHhhhheeeecccccCCccchhhhhhhhccceEEEEEEE
Confidence 865555589999999999876542 2444 4666788999999999999999999999999999999999999999999
Q ss_pred EEecccceeeeEEEEEecCCCCeeeecccccccCCCCCCCCccccCCCCCCceeeeccCcccchhhhhhhhcccCCCCCC
Q psy11213 245 TRSTEVKPLMTVATYTCDMCGAETYQPISSLSFTPLLMCPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHSDQVPVG 324 (621)
Q Consensus 245 ~r~s~v~p~~~~~~f~C~~Cg~~~~~~~~~~~~~~~~~Cp~~~C~~~~~~~~~~~~~~~s~~~d~Q~i~iQe~~~~~~~g 324 (621)
||+|+|||.+.+++|.|..||+++||++++..|+|+..||+++|..++.+|.++++...|+|+.||++|+||..+++|.|
T Consensus 168 TR~S~VKP~m~VatYtCd~CGaE~yQeV~s~~F~pl~~CpS~eC~~n~~~G~L~lqtRgSKFikfQe~kmQEls~qVPvG 247 (721)
T KOG0482|consen 168 TRVSDVKPSMVVATYTCDQCGAETYQEVNSRTFTPLSECPSEECRTNKAGGRLYLQTRGSKFIKFQEVKMQELSDQVPVG 247 (721)
T ss_pred EeccccccceEEEEEecccccHhhhccccCccccchhhCChHHhhhcccCCeEEEEecccccchhhhhhHHHHhccCCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CcccceeeecccccccccccCceEEEeeeeeccccCCceeeec-------------------------------------
Q psy11213 325 NIPRGITVLCRGENTRQVVPGDHVSVSGIFLPLLRTGFRQVTQ------------------------------------- 367 (621)
Q Consensus 325 ~~p~~i~v~l~~~lv~~~~~G~~v~v~Gil~~~~~~~~~~~~~------------------------------------- 367 (621)
++||+++|++.++++.+|.|||.|.|+||+.|....||+....
T Consensus 248 ~IPRsltv~~~ge~tr~~~PGDvV~vsGiFLP~pytGfr~~~aGLladtYLeAh~v~~~nk~~~~~~~~~~~~~~~~~~~ 327 (721)
T KOG0482|consen 248 HIPRSLTVHVYGEMTRKCQPGDVVVVSGIFLPIPYTGFRALKAGLLADTYLEAHRVVQINKKYDNIEKTGELEPEELELI 327 (721)
T ss_pred ccCceeEEEEecccceecCCCCEEEEeeeecccchhhHHHHHhhhHHHHHHHHhhhhhhccccccccccccccHHHHHHh
Confidence 9999999999999999999999999999999988777654331
Q ss_pred ----------------------------------------------CcccEEEeCCCCcchhHHHHHHHhhccccEEecC
Q psy11213 368 ----------------------------------------------GNINICLMGDPGVAKSQLLSYIERLARRSQYTTG 401 (621)
Q Consensus 368 ----------------------------------------------g~i~vLL~G~PGtGKS~ll~~ia~~~pr~~~~~g 401 (621)
|+|||+|+||||++||||++++.+++||++||+|
T Consensus 328 ~~~d~yekLa~SiAPEIyGheDVKKaLLLlLVGgvd~~~~dGMKIRGdINicLmGDPGVAKSQLLkyi~rlapRgvYTTG 407 (721)
T KOG0482|consen 328 AEGDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDKSPGDGMKIRGDINICLMGDPGVAKSQLLKYISRLAPRGVYTTG 407 (721)
T ss_pred hcccHHHHHHHhhchhhccchHHHHHHHHHhhCCCCCCCCCCceeecceeEEecCCCchhHHHHHHHHHhcCcccceecC
Confidence 9999999999999999999999999999999999
Q ss_pred CCCccccceEEEeecCcccceeeeccceeecCCCeeEecCCCCCChhhhhhhHhhhcceEEEEecCCeEEecCCcceEEe
Q psy11213 402 RGSSGVGLTAAVMKDPITNEMVLEGGALVLADQGICCIDEFDKLPDADRTAIHEVMEQQTISIAKAGIMTRLNARVSILA 481 (621)
Q Consensus 402 ~~~s~~gLta~~~~~~~~g~~~l~~GalvlAd~gi~~IDEidk~~~~~~~~L~eame~q~isi~k~gi~~~l~ar~~viA 481 (621)
+|+|++||||++.+|+.+|+.++|+||||+||+|||||||||||.+.+|.+|||+||||+|||+||||.++|||||+|+|
T Consensus 408 rGSSGVGLTAAVmkDpvTgEM~LEGGALVLAD~GICCIDEfDKM~e~DRtAIHEVMEQQTISIaKAGI~TtLNAR~sILa 487 (721)
T KOG0482|consen 408 RGSSGVGLTAAVMKDPVTGEMVLEGGALVLADGGICCIDEFDKMDESDRTAIHEVMEQQTISIAKAGINTTLNARTSILA 487 (721)
T ss_pred CCCCccccchhhhcCCCCCeeEeccceEEEccCceEeehhhhhhhhhhhHHHHHHHHhhhhhhhhhccccchhhhHHhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ecCCCCCCCCCCCCcccccCCCHhHhccccEEEEecCCCChHHHHHHHHHHHhhhccCCCCCCCCCCCCHHHHHHHHHHH
Q psy11213 482 AANPAYGRYNPKRSIEQNIQLPAALLSRFDLLWLIQDKPDRDNDLKLAQHITYVHKHSRQPPTELKPIDMSLVRRYIDLC 561 (621)
Q Consensus 482 a~Np~~g~~~~~~~~~~~~~L~~aLlsRFDli~~~~d~~d~~~d~~ia~~il~~~~~~~~~~~~~~~i~~~~lr~~i~~a 561 (621)
||||.+|||||..++..|++||+||||||||++++.|.||.+.|..+|+||...|+++.+++...++++++.+|.||.+|
T Consensus 488 AANPayGRYnprrs~e~NI~LPaALLSRFDll~Li~D~pdrd~D~~LA~HiTyVH~H~~qp~~~fepl~~~~mR~yI~~a 567 (721)
T KOG0482|consen 488 AANPAYGRYNPRRSPEQNINLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHEEQPPLDFEPLDPNLMRRYISLA 567 (721)
T ss_pred hcCccccccCcccChhHhcCCcHHHHHhhhhhhhhccCCcccchHHHHHHhHhhhccCCCCCccCCCCCHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HcCCCCCCHHHHHHHHHHHHHHHHHhhcCCCCCccCHHHHHHHHHHHHHHHHhcCCCCCC
Q psy11213 562 KGKNPTVPSSLTEHIVKAYTELRKVARNSRDMSYTSARNLLAILRLSTALARLRLCDEFQ 621 (621)
Q Consensus 562 r~~~p~ls~~a~~~l~~~y~~lR~~~~~~~~~~~~t~R~leslirla~A~Akl~lr~~V~ 621 (621)
|+.+|.++++..++|...|++||+.++...+...+|+|.|.+++|||.|+|||++++.|+
T Consensus 568 k~~~P~vp~~l~dyi~~AYv~~Rrea~~~~~~t~ttpRtLL~IlRls~AlarLRls~~V~ 627 (721)
T KOG0482|consen 568 KRKNPVVPEALADYITGAYVELRREARSSKDFTYTTPRTLLGILRLSTALARLRLSDSVE 627 (721)
T ss_pred hhcCCCCCHHHHHHHHHHHHHHHHHhhccCCCcccCHHHHHHHHHHHHHHHHhhhccccc
Confidence 999999999999999999999999998777888899999999999999999999999885
|
|
| >KOG0480|consensus | Back alignment and domain information |
|---|
| >KOG0477|consensus | Back alignment and domain information |
|---|
| >COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0478|consensus | Back alignment and domain information |
|---|
| >KOG0481|consensus | Back alignment and domain information |
|---|
| >KOG0479|consensus | Back alignment and domain information |
|---|
| >PTZ00111 DNA replication licensing factor MCM4; Provisional | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PF14551 MCM_N: MCM N-terminal domain; PDB: 2VL6_C 3F9V_A 1LTL_E | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >KOG0737|consensus | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >KOG2004|consensus | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0734|consensus | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >KOG0738|consensus | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >KOG2028|consensus | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >KOG0745|consensus | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0652|consensus | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >KOG0731|consensus | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0727|consensus | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0740|consensus | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >KOG0739|consensus | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >KOG0742|consensus | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0743|consensus | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PHA01747 putative ATP-dependent protease | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0726|consensus | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0744|consensus | Back alignment and domain information |
|---|
| >KOG0728|consensus | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0735|consensus | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0991|consensus | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG1808|consensus | Back alignment and domain information |
|---|
| >KOG0651|consensus | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13337 Lon_2: Putative ATP-dependent Lon protease | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1051|consensus | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0741|consensus | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length | Back alignment and domain information |
|---|
| >COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0729|consensus | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1942|consensus | Back alignment and domain information |
|---|
| >KOG0990|consensus | Back alignment and domain information |
|---|
| >KOG0732|consensus | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG2035|consensus | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02653 Lon_rel_chp conserved hypothetical protein | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >KOG1969|consensus | Back alignment and domain information |
|---|
| >KOG2680|consensus | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >KOG0735|consensus | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PF13654 AAA_32: AAA domain; PDB: 3K1J_B | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3347|consensus | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PRK05818 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PF13148 DUF3987: Protein of unknown function (DUF3987) | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1514|consensus | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >KOG1970|consensus | Back alignment and domain information |
|---|
| >KOG3595|consensus | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >COG4930 Predicted ATP-dependent Lon-type protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06581 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01057 Parvo_NS1: Parvovirus non-structural protein NS1; InterPro: IPR001257 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK07276 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >KOG2545|consensus | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >KOG0482|consensus | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >KOG0064|consensus | Back alignment and domain information |
|---|
| >PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >KOG2170|consensus | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK08485 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >cd04117 Rab15 Rab15 subfamily | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0060|consensus | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >cd04140 ARHI_like ARHI subfamily | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >KOG0058|consensus | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 621 | ||||
| 3f9v_A | 595 | Crystal Structure Of A Near Full-Length Archaeal Mc | 2e-54 | ||
| 2vl6_A | 268 | Structural Analysis Of The Sulfolobus Solfataricus | 4e-12 | ||
| 3f8t_A | 506 | Crystal Structure Analysis Of A Full-Length Mcm Hom | 2e-11 | ||
| 1ltl_A | 279 | The Dodecamer Structure Of Mcm From Archaeal M. The | 1e-10 |
| >pdb|3F9V|A Chain A, Crystal Structure Of A Near Full-Length Archaeal Mcm: Functional Insights For An Aaa+ Hexameric Helicase Length = 595 | Back alignment and structure |
|
| >pdb|2VL6|A Chain A, Structural Analysis Of The Sulfolobus Solfataricus Mcm Protein N-Terminal Domain Length = 268 | Back alignment and structure |
| >pdb|3F8T|A Chain A, Crystal Structure Analysis Of A Full-Length Mcm Homolog From Methanopyrus Kandleri Length = 506 | Back alignment and structure |
| >pdb|1LTL|A Chain A, The Dodecamer Structure Of Mcm From Archaeal M. Thermoautotrophicum Length = 279 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 621 | |||
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 1e-140 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 1e-65 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 1e-116 | |
| 2vl6_A | 268 | SSO MCM N-TER, minichromosome maintenance protein | 6e-44 | |
| 1ltl_A | 279 | DNA replication initiator (CDC21/CDC54); HET: DNA; | 1e-40 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 2e-07 |
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Length = 595 | Back alignment and structure |
|---|
Score = 419 bits (1080), Expect = e-140
Identities = 116/254 (45%), Positives = 164/254 (64%), Gaps = 7/254 (2%)
Query: 368 GNINICLMGDPGVAKSQLLSYIERLARRSQYTTGRGSSGVGLTAAVMKDPITNEMVLEGG 427
G+I+I ++GDPG AKSQ+L +I R+A R+ YTTG+GS+ GLTAAV+++ T E LE G
Sbjct: 326 GDIHILIIGDPGTAKSQMLQFISRVAPRAVYTTGKGSTAAGLTAAVVREKGTGEYYLEAG 385
Query: 428 ALVLADQGICCIDEFDKLPDADRTAIHEVMEQQTISIAKAGIMTRLNARVSILAAANPAY 487
ALVLAD GI IDE DK+ D DR AIHE MEQQT+SIAKAGI+ +LNAR +++AA NP +
Sbjct: 386 ALVLADGGIAVIDEIDKMRDEDRVAIHEAMEQQTVSIAKAGIVAKLNARAAVIAAGNPKF 445
Query: 488 GRYNPKRSIEQNIQLPAALLSRFDLLWLIQDKPDRDNDLKLAQHITYVHKHSRQPPTELK 547
GRY +R + NI LP +LSRFDL+++++D+P + D +LA +I VH
Sbjct: 446 GRYISERPVSDNINLPPTILSRFDLIFILKDQPG-EQDRELANYILDVHSGKSTKN---- 500
Query: 548 PIDMSLVRRYIDLCKGK-NPTVPSSLTEHIVKAYTELRKVARNSRDMS-YTSARNLLAIL 605
ID+ +R+YI + P + S I + E+RK + + D + R L A++
Sbjct: 501 IIDIDTLRKYIAYARKYVTPKITSEAKNLITDFFVEMRKKSSETPDSPILITPRQLEALI 560
Query: 606 RLSTALARLRLCDE 619
R+S A A++ L E
Sbjct: 561 RISEAYAKMALKAE 574
|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Length = 595 | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Length = 506 | Back alignment and structure |
|---|
| >2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-BIND ssDNA binding; 2.8A {Sulfolobus solfataricus} Length = 268 | Back alignment and structure |
|---|
| >1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 Length = 279 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Length = 350 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 621 | |||
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 100.0 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 100.0 | |
| 2vl6_A | 268 | SSO MCM N-TER, minichromosome maintenance protein | 100.0 | |
| 1ltl_A | 279 | DNA replication initiator (CDC21/CDC54); HET: DNA; | 100.0 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 99.9 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 99.87 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 99.86 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 99.7 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 99.58 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 99.56 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 99.51 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 99.49 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 99.49 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 99.48 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 99.47 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 99.4 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.39 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 99.37 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 99.35 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 99.35 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 99.35 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.3 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 99.28 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 99.27 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 99.27 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 99.24 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 99.21 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 99.21 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 99.2 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 99.2 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 99.2 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 99.19 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 99.19 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 99.19 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.19 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 99.19 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 99.18 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 99.17 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 99.17 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.17 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 99.16 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 99.15 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 99.14 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 99.14 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 99.12 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 99.12 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 99.12 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.12 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 99.11 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 99.1 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 99.09 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 99.0 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 98.99 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 98.98 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 98.98 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 98.96 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 98.94 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 98.93 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 98.92 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 98.87 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 98.86 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 98.86 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 98.84 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 98.82 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 98.81 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 98.8 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 98.78 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 98.75 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 98.74 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 98.74 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 98.72 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 98.72 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 98.71 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 98.68 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 98.67 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 98.66 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 98.66 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 98.62 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 98.62 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 98.6 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 98.56 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 98.56 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 98.56 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 98.53 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 98.53 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 98.52 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 98.45 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 98.43 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 98.32 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 98.23 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 98.21 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 98.2 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 97.97 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.71 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 97.67 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 97.47 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 97.37 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 97.25 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 96.76 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 96.64 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.78 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 95.64 | |
| 1jr3_D | 343 | DNA polymerase III, delta subunit; processivity, p | 95.59 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 95.36 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 95.36 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 95.22 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 95.21 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 95.11 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 95.11 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 94.97 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 94.96 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 94.86 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 94.85 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 94.64 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 94.61 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 94.59 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 94.59 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 94.55 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 94.47 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 94.47 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 94.44 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 94.43 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 94.35 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 94.35 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 94.33 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 94.27 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 94.27 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 94.27 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 94.25 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 94.23 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 94.2 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 94.16 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 94.15 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 94.13 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 94.09 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 94.02 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 94.02 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 93.98 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 93.96 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 93.88 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 93.88 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 93.82 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 93.76 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 93.76 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 93.75 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 93.71 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 93.7 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 93.67 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 93.67 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 93.64 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 93.62 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 93.61 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 93.58 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 93.53 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 93.51 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 93.4 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 93.36 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 93.35 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 93.33 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 93.28 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 93.09 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 93.06 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 92.89 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 92.7 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 92.64 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 92.64 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 92.62 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 92.6 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 92.57 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 92.56 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 92.55 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 92.55 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 92.54 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 92.5 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 92.45 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 92.45 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 92.39 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 92.39 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 92.39 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 92.38 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 92.37 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 92.37 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 92.36 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 92.35 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 92.34 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 92.32 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 92.28 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 92.27 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 92.26 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 92.25 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 92.21 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 92.2 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 92.16 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 92.15 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 92.14 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 92.13 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 92.07 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 92.05 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 92.05 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 92.05 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 92.03 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 92.02 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 92.01 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 91.98 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 91.97 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 91.96 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 91.94 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 91.93 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 91.92 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 91.92 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 91.9 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 91.89 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 91.88 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 91.87 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 91.86 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 91.86 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 91.81 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 91.79 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 91.75 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 91.74 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 91.74 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 91.73 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 91.63 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 91.63 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 91.61 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 91.59 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 91.54 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 91.52 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 91.5 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 91.46 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 91.45 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 91.4 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 91.39 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 91.37 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 91.35 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 91.34 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 91.33 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 91.33 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 91.32 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 91.31 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 91.29 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 91.29 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 91.27 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 91.26 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 91.23 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 91.21 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 91.21 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 91.15 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 91.14 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 91.14 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 91.14 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 91.13 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 91.11 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 91.09 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 91.07 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 91.06 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 91.05 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 91.02 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 91.02 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 91.01 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 91.01 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 91.0 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 90.96 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 90.96 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 90.94 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 90.94 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 90.93 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 90.93 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 90.92 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 90.91 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 90.91 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 90.9 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 90.9 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 90.87 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 90.86 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 90.83 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 90.82 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 90.82 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 90.8 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 90.79 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 90.78 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 90.73 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 90.71 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 90.7 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 90.68 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 90.66 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 90.66 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 90.66 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 90.66 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 90.65 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 90.63 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 90.62 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 90.61 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 90.59 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 90.52 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 90.5 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 90.49 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 90.47 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 90.46 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 90.44 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 90.43 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 90.43 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 90.42 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 90.38 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 90.36 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 90.36 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 90.35 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 90.34 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 90.31 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 90.28 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 90.24 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 90.21 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 90.16 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 90.16 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 90.12 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 90.06 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 89.91 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 89.88 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 89.84 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 89.83 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 89.83 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 89.82 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 89.81 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 89.73 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 89.69 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 89.68 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 89.63 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 89.63 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 89.63 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 89.58 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 89.56 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 89.56 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 89.55 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 89.53 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 89.52 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 89.5 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 89.47 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 89.43 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 89.43 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 89.42 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 89.35 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 89.34 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 89.25 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 89.25 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 89.24 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 89.18 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 89.1 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 89.09 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 89.08 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 89.07 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 89.06 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 89.05 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 89.03 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 89.0 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 88.98 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 88.96 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 88.92 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 88.92 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 88.82 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 88.76 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 88.75 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 88.74 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 88.64 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 88.59 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 88.56 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 88.44 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 88.4 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 88.28 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 88.27 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 88.2 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 88.09 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 88.07 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 87.99 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 87.99 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 87.99 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 87.97 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 87.93 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 87.93 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 87.92 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 87.81 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 87.75 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 87.68 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 87.61 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 87.61 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 87.59 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 87.47 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 87.43 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 87.43 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 87.39 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 87.37 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 87.35 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 87.34 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 87.23 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 87.16 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 87.05 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 86.96 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 86.94 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 86.88 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 86.85 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 86.85 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 86.79 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 86.78 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 86.7 | |
| 2gmg_A | 105 | Hypothetical protein PF0610; winged-helix like pro | 86.66 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 86.65 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 86.65 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 86.57 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 86.51 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 86.48 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 86.47 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 86.46 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 86.4 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 86.25 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 86.16 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 86.14 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 86.07 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 85.94 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 85.78 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 85.77 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 85.59 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 85.5 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 85.47 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 85.59 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 85.26 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 85.2 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 85.12 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 85.08 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 85.02 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 84.96 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 84.88 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 84.86 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 84.83 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 84.79 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 84.71 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 84.68 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 84.45 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 84.37 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 84.35 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 84.3 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 84.26 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 84.13 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 84.04 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 83.91 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 83.9 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 83.89 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 83.69 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 83.64 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 83.53 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 83.47 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 83.27 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 83.08 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 82.97 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 82.94 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 82.92 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 82.74 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 82.73 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 82.6 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 82.55 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 82.35 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 81.99 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 81.99 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 81.96 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 81.91 | |
| 1jal_A | 363 | YCHF protein; nucleotide-binding fold, structural | 81.85 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 81.84 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 81.84 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 81.82 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 81.75 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 81.75 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 81.74 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 81.69 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 81.68 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 81.47 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 81.43 | |
| 2dby_A | 368 | GTP-binding protein; GDP, structural genomics, NPP | 81.33 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 81.23 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 81.22 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 81.17 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 81.1 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 81.01 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 80.95 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 80.91 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 80.9 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 80.76 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 80.64 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 80.45 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 80.42 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 80.41 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 80.15 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 80.14 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 80.06 |
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
Probab=100.00 E-value=5.4e-82 Score=713.93 Aligned_cols=484 Identities=37% Similarity=0.605 Sum_probs=429.5
Q ss_pred hhhHHHHHHhcccccccCcchhchHHHHHHHHHcCCcEEEEechhhhcccHHHHHHHHHcHHHHHHHHHHHHHHhcCCCc
Q psy11213 86 IDLDDEFLIEFVKIDKDDNKIFKYSKQLSKLAHREQVAIYIDLDDVEEFNSDLATNIQNNTRRYVQMFSELIFELLPDYK 165 (621)
Q Consensus 86 i~~~~~Fl~~F~~~~~~~~~~~~Y~~~i~~~~~~~~~~l~Vd~~dL~~fd~~La~~i~~np~~~l~l~~~av~el~~~~~ 165 (621)
.+.+++||++|.+. ++.++|+++|++|+..++.+|+||++||.+|+++||++|+++|.+++++|++|+.++++...
T Consensus 5 ~~~f~~Fl~~~~~~----~~~~~y~~~i~~~~~~~~~~l~v~~~~l~~~~~~l~~~l~~~p~~~~~~~~~a~~~~~~~~~ 80 (595)
T 3f9v_A 5 RDVFIEFLTTFKGN----NNQNKYIERINELVAYRKKSLIIEFSDVLSFNENLAYEIINNTKIILPILEGALYDHILQLD 80 (595)
T ss_dssp HHHHHHHHHHCCTT----TTSCTTHHHHHHHHHHTCSSCCEEHHHHHTTCTTHHHHHHTTHHHHHHHHHHHHHHHHHHHC
T ss_pred HHHHHHHHHhhhcc----CCChhHHHHHHHHHHcCCcEEEEEhHHHhhhCHHHHHHHHHCHHHHHHHHHHHHHHHHHhhc
Confidence 35678999999753 24788999999999999999999999999999999999999999999999999998764211
Q ss_pred ccccccCChhhHHHHHHHHHhhhCCCCcccccccccCCcccccceeEEEEeCCCCCCCcccccccccCCCcEEEEEEEEE
Q psy11213 166 SHDVIAKDPLDIYIEHRLLLEQRNHPNPQELRNSQNRYPQDLMRRFEVYFVPPSSGKPTPIREVKATHIGKLVNVRGVVT 245 (621)
Q Consensus 166 ~~~~~~~d~ld~~~~~~~~~e~~~~~~~~~~~~~~~~~p~~l~~~~~v~~~~~~~~~~~~ir~l~s~~igkLV~i~GiV~ 245 (621)
+ .+.. ..++++|+|.+++ ...++|+|++.++||||+|+|+|+
T Consensus 81 ---------------------------~--------~~~~-~~~~~~v~~~~~~--~~~~~r~l~~~~i~~lv~v~G~V~ 122 (595)
T 3f9v_A 81 ---------------------------P--------TYQR-DIEKVHVRIVGIP--RVIELRKIRSTDIGKLITIDGILV 122 (595)
T ss_dssp ---------------------------G--------GGTT-TCCCCCCCEECCS--CEECGGGCCGGGTTCCEEEEEEEE
T ss_pred ---------------------------h--------hhhh-ccceEEEEEeCCC--CCCChhhcchhhCCcEEEEEEEEE
Confidence 0 0000 1235778888877 568999999999999999999999
Q ss_pred EecccceeeeEEEEEecC--CCCeeeec---ccccccCCCCCCCCccccCCCCCCceeeeccCcccchhhhhhhhcccCC
Q psy11213 246 RSTEVKPLMTVATYTCDM--CGAETYQP---ISSLSFTPLLMCPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHSDQ 320 (621)
Q Consensus 246 r~s~v~p~~~~~~f~C~~--Cg~~~~~~---~~~~~~~~~~~Cp~~~C~~~~~~~~~~~~~~~s~~~d~Q~i~iQe~~~~ 320 (621)
|+|.|+|++.+++|.|.+ ||+.++.+ ..+..+.+|..||+ |++ .|+|.++.+.|.|+|||+|+|||.|+.
T Consensus 123 r~s~v~~~~~~~~~~C~~~~C~~~~~~~~~~~~~~~~~~p~~C~~--C~~---~~~~~~~~~~s~~~d~Q~i~iQe~~~~ 197 (595)
T 3f9v_A 123 KVTPVKERIYKATYKHIHPDCMQEFEWPEDEEMPEVLEMPTICPK--CGK---PGQFRLIPEKTKLIDWQKAVIQERPEE 197 (595)
T ss_dssp EECCCEEEEEECCCEEESSSCCCBCCSSCSSCCCSSCCCCSSCTT--TCC---CSEEECCSTTCEEEEEEEEEEECCTTT
T ss_pred EecCEEEEEEEEEEEecCCCCCCEEEEEeccccCCcccCCCcCCC--CCC---CCceEEeccCceeeeeEEEEEEecccc
Confidence 999999999999999999 99987766 34567889999986 874 458999999999999999999999999
Q ss_pred CCCCCcccceeeecccccccccccCceEEEeeeeeccccCC--------ceeeec-------------------------
Q psy11213 321 VPVGNIPRGITVLCRGENTRQVVPGDHVSVSGIFLPLLRTG--------FRQVTQ------------------------- 367 (621)
Q Consensus 321 ~~~g~~p~~i~v~l~~~lv~~~~~G~~v~v~Gil~~~~~~~--------~~~~~~------------------------- 367 (621)
+|.|++||+++|+|++|||++++|||+|.|+||+.+....+ |.....
T Consensus 198 ~~~g~~pr~~~v~l~~dlv~~~~pGd~v~v~Gi~~~~~~~~~~~~~~~~~~~~i~a~~i~~~~~~~~~~~~t~~~~~~i~ 277 (595)
T 3f9v_A 198 VPSGQLPRQLEIILEDDLVDSARPGDRVKVTGILDIKQDSPVKRGSRAVFDIYMKVSSIEVSQKVLDEVIISEEDEKKIK 277 (595)
T ss_dssp SCTTSCCCEEEEEEEGGGTTCSCSSCEEEEEEECCCCCSSTTSCTTCCCCCCCCEEEEEEECCCCCCCCCCTTSTHHHHH
T ss_pred CCCCCCCceEEEEEecccccccccCCEEEEEEEEEecccccccCCCcceEEEEEEEEeecccccccccCCCCHHHHHHHH
Confidence 99999999999999999999999999999999997554311 110000
Q ss_pred -----------------------------------Cc-------------ccEEEeCCCCcchhHHHHHHHhhccccEEe
Q psy11213 368 -----------------------------------GN-------------INICLMGDPGVAKSQLLSYIERLARRSQYT 399 (621)
Q Consensus 368 -----------------------------------g~-------------i~vLL~G~PGtGKS~ll~~ia~~~pr~~~~ 399 (621)
|+ +||||+||||||||+||+++++.+++..++
T Consensus 278 ~~~~~~~~~~~l~~~l~~~I~G~e~vk~al~~~l~~g~~~~~~~~~~r~~~~vLL~GppGtGKT~LAr~la~~~~r~~~~ 357 (595)
T 3f9v_A 278 DLAKDPWIRDRIISSIAPSIYGHWELKEALALALFGGVPKVLEDTRIRGDIHILIIGDPGTAKSQMLQFISRVAPRAVYT 357 (595)
T ss_dssp TTSSTTTGGGTHHHHTSSTTSCCHHHHHHHTTTTTCCCCEETTTTEECCSCCEEEEESSCCTHHHHHHSSSTTCSCEECC
T ss_pred HHhhCcHHHHHHHHhhcchhcChHHHHHHHHHHHhCCCcccccCCCcCCCcceEEECCCchHHHHHHHHHHHhCCCceec
Confidence 44 399999999999999999999999999999
Q ss_pred cCCCCccccceEEEeecCcccceeeeccceeecCCCeeEecCCCCCChhhhhhhHhhhcceEEEEecCCeEEecCCcceE
Q psy11213 400 TGRGSSGVGLTAAVMKDPITNEMVLEGGALVLADQGICCIDEFDKLPDADRTAIHEVMEQQTISIAKAGIMTRLNARVSI 479 (621)
Q Consensus 400 ~g~~~s~~gLta~~~~~~~~g~~~l~~GalvlAd~gi~~IDEidk~~~~~~~~L~eame~q~isi~k~gi~~~l~ar~~v 479 (621)
.+.+.+..|++++...+..+|.+..++|++.+|++|||||||||+|+++.+++||++||++++++.++|....++++++|
T Consensus 358 ~~~~~~~~~l~~~~~~~~~~g~~~~~~G~l~~A~~gil~IDEid~l~~~~q~~Ll~~le~~~i~i~~~g~~~~~~~~~~v 437 (595)
T 3f9v_A 358 TGKGSTAAGLTAAVVREKGTGEYYLEAGALVLADGGIAVIDEIDKMRDEDRVAIHEAMEQQTVSIAKAGIVAKLNARAAV 437 (595)
T ss_dssp CTTCSTTTTSEEECSSGGGTSSCSEEECHHHHHSSSEECCTTTTCCCSHHHHHHHHHHHSSSEEEESSSSEEEECCCCEE
T ss_pred CCCccccccccceeeeccccccccccCCeeEecCCCcEEeehhhhCCHhHhhhhHHHHhCCEEEEecCCcEEEecCceEE
Confidence 99888899999999988889999999999999999999999999999999999999999999999999999999999999
Q ss_pred EeecCCCCCCCCCCCCcccccCCCHhHhccccEEEEecCCCChHHHHHHHHHHHhhhccCCCCCCCCCCCCHHHHHHHHH
Q psy11213 480 LAAANPAYGRYNPKRSIEQNIQLPAALLSRFDLLWLIQDKPDRDNDLKLAQHITYVHKHSRQPPTELKPIDMSLVRRYID 559 (621)
Q Consensus 480 iAa~Np~~g~~~~~~~~~~~~~L~~aLlsRFDli~~~~d~~d~~~d~~ia~~il~~~~~~~~~~~~~~~i~~~~lr~~i~ 559 (621)
|||+||.+|+|++.+++.+|+.|++||+||||+++++.|.|+.+ +..|++|++..|... ...+.++.+.|++|+.
T Consensus 438 IaatNp~~G~~~~~~~~~~ni~l~~aLl~RFDl~~~~~~~~~~e-~~~i~~~il~~~~~~----~~~~~l~~~~l~~~i~ 512 (595)
T 3f9v_A 438 IAAGNPKFGRYISERPVSDNINLPPTILSRFDLIFILKDQPGEQ-DRELANYILDVHSGK----STKNIIDIDTLRKYIA 512 (595)
T ss_dssp EEEECCTTCCSCTTSCSCTTTCSCSSSGGGCSCCEEECCTTHHH-HHHHHHHHHTTTCCC----SSSSTTCCTTTHHHHH
T ss_pred EEEcCCcCCccCcccCchhccCCCHHHHhhCeEEEEeCCCCCHH-HHHHHHHHHHHhhcc----ccccCCCHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999 999999999877542 3456789999999999
Q ss_pred HHHcC-CCCCCHHHHHHHHHHHHHHHHHhhcCC-CCCccCHHHHHHHHHHHHHHHHhcCCCCCC
Q psy11213 560 LCKGK-NPTVPSSLTEHIVKAYTELRKVARNSR-DMSYTSARNLLAILRLSTALARLRLCDEFQ 621 (621)
Q Consensus 560 ~ar~~-~p~ls~~a~~~l~~~y~~lR~~~~~~~-~~~~~t~R~leslirla~A~Akl~lr~~V~ 621 (621)
||++. .|.+++++.+.|.++|.++|+...... ...++|+|++++++|+|+|+|++++++.|+
T Consensus 513 ~ar~~~~p~ls~ea~~~l~~~y~~lR~~~~~~~~~~~~~s~R~l~~lirla~a~A~l~~~~~V~ 576 (595)
T 3f9v_A 513 YARKYVTPKITSEAKNLITDFFVEMRKKSSETPDSPILITPRQLEALIRISEAYAKMALKAEVT 576 (595)
T ss_dssp HHHHHHCCCCCCCTHHHHHHHHTTSSCSCCBCSSSCBCSSTTTTTHHHHHHHHHHHTTSSCCSS
T ss_pred HHHHhCCCCCCHHHHHHHHHHHHHHHHhhccCCCccccccHHHHHHHHHHHHHHHHHhCcCCCC
Confidence 99988 999999999999999999998755432 246799999999999999999999999986
|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-BIND ssDNA binding; 2.8A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 621 | ||||
| d1ltla_ | 239 | b.40.4.11 (A:) DNA replication initiator (cdc21/cd | 1e-38 | |
| d1g8pa_ | 333 | c.37.1.20 (A:) ATPase subunit of magnesium chelata | 4e-12 | |
| d1ny5a2 | 247 | c.37.1.20 (A:138-384) Transcriptional activator si | 3e-04 |
| >d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 239 | Back information, alignment and structure |
|---|
class: All beta proteins fold: OB-fold superfamily: Nucleic acid-binding proteins family: DNA replication initiator (cdc21/cdc54) N-terminal domain domain: DNA replication initiator (cdc21/cdc54) N-terminal domain species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Score = 140 bits (354), Expect = 1e-38
Identities = 49/208 (23%), Positives = 87/208 (41%), Gaps = 10/208 (4%)
Query: 153 FSELIFELLPDYKSHDVIAKDPLDIYIEHRLLLEQRNHPNPQELRNSQN---RYPQDLMR 209
+ + +FE + Y + I D LD+ + L + P ++ + R L +
Sbjct: 19 YKDRVFEAIEKYPNVRSIEVDYLDLEMFDPDLADLLIE-KPDDVIRAAQQAIRNIDRLRK 77
Query: 210 RFEVYFVPPSSGKPTPIREVKATHIGKLVNVRGVVTRSTEVKPLMTVATYTCDMCGAETY 269
++ P+RE+++ IGK V V G+V ++ E++P + A + C C
Sbjct: 78 NVDLNIRFSGISNVIPLRELRSKFIGKFVAVDGIVRKTDEIRPRIVKAVFECRGCMRHHA 137
Query: 270 QPISSLSFTPLLMCPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHSDQVPVGNIPRG 329
S+ T +C + L S+F+ Q LK+QE + + G PR
Sbjct: 138 VTQSTNMITEPSLCSECGGR------SFRLLQDESEFLDTQTLKLQEPLENLSGGEQPRQ 191
Query: 330 ITVLCRGENTRQVVPGDHVSVSGIFLPL 357
ITV+ + + PGD V V+G +
Sbjct: 192 ITVVLEDDLVDTLTPGDIVRVTGTLRTV 219
|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 621 | |||
| d1ltla_ | 239 | DNA replication initiator (cdc21/cdc54) N-terminal | 100.0 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 99.96 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 99.38 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 99.36 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 99.3 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.23 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 99.21 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 99.21 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 99.19 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 99.14 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 99.11 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.1 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 99.09 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.07 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 99.01 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 98.99 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 98.97 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 98.95 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.93 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 98.9 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 98.85 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 98.79 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.73 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 98.71 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 98.6 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 98.6 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 98.46 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 98.43 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 98.28 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 98.26 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 97.95 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 97.95 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.74 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 97.46 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 97.27 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.89 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 96.89 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.83 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.73 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 96.7 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 96.67 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 96.62 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 96.31 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 96.24 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 96.21 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.11 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.09 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.08 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.06 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 96.02 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 96.0 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 95.99 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 95.91 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.89 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 95.62 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 95.61 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 95.58 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 95.57 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 95.52 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 95.5 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 95.46 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 95.39 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 95.34 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 95.14 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 95.09 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 94.9 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 94.73 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 94.66 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.5 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 94.44 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 94.42 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 94.35 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 93.96 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 93.87 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 93.86 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 93.84 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 93.84 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 93.75 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 93.56 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 93.42 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 93.31 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 93.21 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 93.14 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 92.99 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 92.99 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 92.93 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 92.91 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 92.89 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 92.89 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 92.85 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.84 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 92.73 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 92.63 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 92.6 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 92.59 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 92.56 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 92.55 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 92.54 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 92.47 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 92.43 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 92.36 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 92.28 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 92.28 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 92.25 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 92.17 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 92.13 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 92.12 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 92.12 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 92.12 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 92.08 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 92.06 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 92.05 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 92.03 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 92.01 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 91.96 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 91.96 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 91.87 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 91.74 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 91.65 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 91.64 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 91.47 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 91.45 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 91.44 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 91.36 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 91.36 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 91.32 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 91.3 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 91.21 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 91.18 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 91.15 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 91.08 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 91.05 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 90.92 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 90.91 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 90.85 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 90.84 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 90.8 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 90.72 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 90.7 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 90.67 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 90.67 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 90.43 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 90.41 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 90.4 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 90.34 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 90.33 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 90.27 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 90.27 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 90.23 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 90.16 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 90.13 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 89.89 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 89.87 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 89.83 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 89.6 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 89.53 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 89.5 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 89.39 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 89.35 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 89.27 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 89.21 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 89.17 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 89.1 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 89.05 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 89.02 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 88.97 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 88.97 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 88.85 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 88.65 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 88.6 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 88.56 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 88.5 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 88.35 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 88.06 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 87.95 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 87.6 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 87.37 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 87.26 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 87.19 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 87.18 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 87.06 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 87.03 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 87.02 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 86.73 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 86.49 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 86.47 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 86.29 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 86.06 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 85.92 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 85.91 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 85.51 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 85.47 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 85.23 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 85.15 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 85.13 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 85.12 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 85.07 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 85.03 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 84.96 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 84.47 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 84.04 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 83.49 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 82.93 | |
| d2gmga1 | 105 | Hypothetical protein PF0610 {Pyrococcus furiosus [ | 82.77 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 82.24 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 82.15 | |
| d1lkoa2 | 44 | Rubrerythrin, C-terminal domain {Desulfovibrio vul | 82.02 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 81.53 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 81.37 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 81.13 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 80.62 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 80.58 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 80.57 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 80.49 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 80.27 |
| >d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: OB-fold superfamily: Nucleic acid-binding proteins family: DNA replication initiator (cdc21/cdc54) N-terminal domain domain: DNA replication initiator (cdc21/cdc54) N-terminal domain species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=100.00 E-value=3.4e-38 Score=314.39 Aligned_cols=201 Identities=26% Similarity=0.414 Sum_probs=178.0
Q ss_pred chHHHHHHHHHc--CCcEEEEechhhhcccHHHHHHHHHcHHHHHHHHHHHHHHhcCCCcccccccCChhhHHHHHHHHH
Q psy11213 108 KYSKQLSKLAHR--EQVAIYIDLDDVEEFNSDLATNIQNNTRRYVQMFSELIFELLPDYKSHDVIAKDPLDIYIEHRLLL 185 (621)
Q Consensus 108 ~Y~~~i~~~~~~--~~~~l~Vd~~dL~~fd~~La~~i~~np~~~l~l~~~av~el~~~~~~~~~~~~d~ld~~~~~~~~~ 185 (621)
.|.++|.+++.. +.++|+|||+||..|+|+|+++|.++|.+++++|++|+.++.....
T Consensus 18 ~y~~~i~~~~~~~~~~~sl~Vd~~~L~~~~~~L~~~l~~~P~~~l~~~~~ai~~~~~~~~-------------------- 77 (239)
T d1ltla_ 18 DYKDRVFEAIEKYPNVRSIEVDYLDLEMFDPDLADLLIEKPDDVIRAAQQAIRNIDRLRK-------------------- 77 (239)
T ss_dssp HHHHHHHHHHHHTTSCCEEEEEHHHHHHHCTTHHHHHHHSHHHHHHHHHHHHTTTCTTCC--------------------
T ss_pred hHHHHHHHHHHcCCCCcEEEEEHHHHHhhCHHHHHHHHHCHHHHHHHHHHHHHhHHhhcc--------------------
Confidence 499999999877 5689999999999999999999999999999999999876431100
Q ss_pred hhhCCCCcccccccccCCcccccceeEEEEeCCCCCCCcccccccccCCCcEEEEEEEEEEecccceeeeEEEEEecCCC
Q psy11213 186 EQRNHPNPQELRNSQNRYPQDLMRRFEVYFVPPSSGKPTPIREVKATHIGKLVNVRGVVTRSTEVKPLMTVATYTCDMCG 265 (621)
Q Consensus 186 e~~~~~~~~~~~~~~~~~p~~l~~~~~v~~~~~~~~~~~~ir~l~s~~igkLV~i~GiV~r~s~v~p~~~~~~f~C~~Cg 265 (621)
+ ..++|++.+.+ ...++|+|++.++||||+|+|+|+|+|.|+|++.+++|.|.+||
T Consensus 78 ----------------~------~~i~vr~~~~~--~~~~ir~l~s~~igkLv~v~GiV~r~s~v~~~~~~~~~~C~~C~ 133 (239)
T d1ltla_ 78 ----------------N------VDLNIRFSGIS--NVIPLRELRSKFIGKFVAVDGIVRKTDEIRPRIVKAVFECRGCM 133 (239)
T ss_dssp ----------------C------CCCEEEEECCS--CBCCGGGCCGGGTTSEEEEEEEEEEECCCEEEEEEEEEEETTTC
T ss_pred ----------------C------ceEEEEEcCCC--CccchhccchhhhccEEEEEEEEEEeCCEEEEEEEEEEECCCCC
Confidence 0 12456676655 57889999999999999999999999999999999999999999
Q ss_pred CeeeecccccccCCCCCCCCccccCCCCCCceeeeccCcccchhhhhhhhcccCCCCCCCcccceeeecccccccccccC
Q psy11213 266 AETYQPISSLSFTPLLMCPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHSDQVPVGNIPRGITVLCRGENTRQVVPG 345 (621)
Q Consensus 266 ~~~~~~~~~~~~~~~~~Cp~~~C~~~~~~~~~~~~~~~s~~~d~Q~i~iQe~~~~~~~g~~p~~i~v~l~~~lv~~~~~G 345 (621)
+.+......+.+.+|..|++ |++ .+|.+..+.|.|+|||+|+|||.|+++|.|++|+++.|+|++||+++++||
T Consensus 134 ~~~~~~~~~~~~~~p~~C~~--C~~----~~f~~~~~~s~~~d~Q~i~iQE~~e~~~~G~~Pr~i~v~l~~dlvd~~~pG 207 (239)
T d1ltla_ 134 RHHAVTQSTNMITEPSLCSE--CGG----RSFRLLQDESEFLDTQTLKLQEPLENLSGGEQPRQITVVLEDDLVDTLTPG 207 (239)
T ss_dssp CEEEEECSSSSCCCCSCCTT--TCC----CCEEECGGGCEEEEEEEEEEECCSTTCCSSCCCCEEEEEEEGGGTTCCCTT
T ss_pred ceEEEEecCCeecCCccCCC--CCC----cccEEccCcceEeeeEEEEEecccccCCCCCCCcEEEEEEeccccCccCCC
Confidence 99888877788888999986 874 358899999999999999999999999999999999999999999999999
Q ss_pred ceEEEeeeeeccc
Q psy11213 346 DHVSVSGIFLPLL 358 (621)
Q Consensus 346 ~~v~v~Gil~~~~ 358 (621)
|+|.|+||+.+..
T Consensus 208 d~V~i~GI~~~~~ 220 (239)
T d1ltla_ 208 DIVRVTGTLRTVR 220 (239)
T ss_dssp CEEEEEEEEEEEE
T ss_pred CEEEEEEEEEEee
Confidence 9999999997654
|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|