Diaphorina citri psyllid: psy1121


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MDTGDEYEVGDSGQPDDGNCHAGRRPRCRRKKVHHSTVVNPDSNLYFYWLLIITCCVLYNLWTLIVRQSFPELQENGAKFWFFCDYTTDTFIVLDILVQFRTGYLEQGNNNNNHITYYERQL
cccccccccccccccccccccccccccHccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEHHHHHHHHHHHHHHHHHccEEEEEcccCECcHHHHHHccc
**********************************HSTVVNPDSNLYFYWLLIITCCVLYNLWTLIVRQSFPELQENGAKFWFFCDYTTDTFIVLDILVQFRTGYLEQGNNNNNHITYYERQL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTGDEYEVGDSGQPDDGNCHAGRRPRCRRKKVHHSTVVNPDSNLYFYWLLIITCCVLYNLWTLIVRQSFPELQENGAKFWFFCDYTTDTFIVLDILVQFRTGYLEQGNNNNNHITYYERQL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cyclic nucleotide-gated channel cone photoreceptor subunit alpha Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cyclic GMP which leads to an opening of the cation channel and thereby causing a depolarization of cone photoreceptors.confidentQ90805

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030553 [MF]cGMP bindingprobableGO:0043168, GO:0030551, GO:0019001, GO:0097159, GO:0000166, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032555, GO:0017076, GO:0043167, GO:1901363, GO:1901265, GO:0005488
GO:0017071 [CC]intracellular cyclic nucleotide activated cation channel complexprobableGO:0043234, GO:0032991, GO:0016021, GO:0016020, GO:0005575, GO:0034702, GO:0034703, GO:0044425, GO:0031224
GO:0005223 [MF]intracellular cGMP activated cation channel activityprobableGO:0022891, GO:0008324, GO:0005261, GO:0043855, GO:0005221, GO:0005215, GO:0005216, GO:0005217, GO:0015276, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022892, GO:0022834, GO:0022803, GO:0022839, GO:0022838
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0008150 [BP]biological_processprobable
GO:0097458 [CC]neuron partprobableGO:0005575, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R9R, chain B
Confidence level:probable
Coverage over the Query: 40-103
View the alignment between query and template
View the model in PyMOL